DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and CG30002

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:293 Identity:77/293 - (26%)
Similarity:119/293 - (40%) Gaps:58/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IINEPITDPQCGFVNSKGVTFSFREEDTGLAQEA--EVPWMVALLDARTSSYVA--------GGA 137
            ::.|.:|...||..:::......|...||..:.:  ..|||..|       ::|        ||:
  Fly    36 LVYENLTQQDCGVRSNQIPAVRIRFMITGGRKSSLMSQPWMAFL-------HIASDLEMCRCGGS 93

  Fly   138 LIAPHVVITARQRTENMTAS-QLVVRAGEWDFSTKTE----------QLPSVDVPIRSIVRHPGF 191
            ||:...|:||....:....| ::.|..||.|.|:.::          ..|..:..|...:.|..|
  Fly    94 LISELFVLTAAHCFKMCPRSKEIRVWLGELDLSSTSDCTTYNYERVCAPPVEEFTIDKWILHEEF 158

  Fly   192 NLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFS-----RCIFTGWGKNSFDDPSYMNVL 251
            ||.....::||:.|.:.:....||.|||:|...:...|:     |.:..||||.  :...|.|  
  Fly   159 NLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQRFMAVGWGKT--ESLRYAN-- 219

  Fly   252 KKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAI----KDNPQR 312
                      .|.|..:|.....|.. |.|.:||.|: ..|:|.||.|.||....    ||...:
  Fly   220 ----------STMEVDIRTEKCTDGR-DTSFLCASGD-YVDTCNGDSGGPLLWKTTLFGKDRAVQ 272

  Fly   313 YELAGIVNFG-VDCGLPGVPAVYTNVANVIEWI 344
            :   |:|:.| .:|| .|..|.|.:|...:.||
  Fly   273 F---GVVSTGSQNCG-AGHKAYYMDVPTYMPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 68/261 (26%)
Tryp_SPc 113..344 CDD:238113 68/261 (26%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 70/265 (26%)
Tryp_SPc 62..301 CDD:238113 70/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.