DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and TPSD1

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:219 Identity:68/219 - (31%)
Similarity:107/219 - (48%) Gaps:33/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 EDTGL--AQEA---EVPWMVALLDARTSS----YVAGGALIAPHVVITARQRTE----NMTASQL 159
            :.||:  .|||   :.||.|:|   |...    :..||:||.|..|:||....|    ::.|.::
Human    34 QQTGIVGGQEAPRSKWPWQVSL---RVRGPYWMHFCGGSLIHPQWVLTAAHCVEPDIKDLAALRV 95

  Fly   160 VVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAP 224
            .:|.....:.   :||    :|:..|:.||.|.:.....::||:.|...:..|.||:.:.:|.|.
Human    96 QLREQHLYYQ---DQL----LPVSRIIVHPQFYIIQTGADIALLELEEPVNISSHIHTVTLPPAS 153

  Fly   225 KNFDFSR-CIFTGWG---KNSFDDPSYMNVLKKISLPVVQRRTC--EQQLRLYYGNDFEL-DNSL 282
            :.|.... |..||||   .|....|.|  .||::.:|||:...|  |....|:.|:.|:: .:.:
Human   154 ETFPPGMPCWVTGWGDVDNNVHLPPPY--PLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDDM 216

  Fly   283 MCAGGEPGKDSCEGDGGSPLACAI 306
            :|||.| ..|||:||.|.||.|.:
Human   217 LCAGSE-NHDSCQGDSGGPLVCKV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 66/212 (31%)
Tryp_SPc 113..344 CDD:238113 66/212 (31%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 66/215 (31%)
Tryp_SPc 38..240 CDD:214473 66/215 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152859
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.