DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and Prss28

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:243 Identity:67/243 - (27%)
Similarity:122/243 - (50%) Gaps:33/243 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSY-------VAGGALIAPHVVITARQRTENMTASQLV--VRAGEWDFSTKTEQ 174
            ||.|:|   |..||       :.||::|.|..::||....::..|...|  |:.|| .:..|.::
Mouse    43 PWQVSL---RMYSYEVNSWVHICGGSIIHPQWILTAAHCIQSQDADPAVYRVQVGE-VYLYKEQE 103

  Fly   175 LPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFS-RCIFTGWG 238
            |    :.|..|:.||.:|..:...::||:.|...|.:|.:::|:.:|.....||.: :|...|||
Mouse   104 L----LNISRIIIHPDYNDVSKRFDLALMQLTALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWG 164

  Fly   239 KNSFD----DPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFE---LDNSLMCAGGEPGKDSCEG 296
             |...    .|.|.  |.::.:|:...::|::..|....::.:   :.:.::|| |..|:..|.|
Mouse   165 -NLLQRVPLQPPYQ--LHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCA-GTSGRGPCFG 225

  Fly   297 DGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            |.|.||.| .|.|  ::...|:|:.|:||. ..:|::::.|.:.:.||
Mouse   226 DSGGPLVC-WKSN--KWIQVGVVSKGIDCS-NNLPSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 65/241 (27%)
Tryp_SPc 113..344 CDD:238113 65/241 (27%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 67/243 (28%)
Tryp_SPc 31..269 CDD:214473 65/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.