DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:418 Identity:101/418 - (24%)
Similarity:165/418 - (39%) Gaps:79/418 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QNAELNQSCGASNEHQCVP-------RHMCKVKIEFRMAMTYRNL-----GCVSTAICCPKNLII 77
            |:||.......|.....:|       .:...|.::.|......|.     .|::|     .:..:
Zfish   230 QSAESGYDTNGSTVFYSIPVSDVTNLPYTSNVNVKGRWVFRVDNSSEVKGSCINT-----NSQAL 289

  Fly    78 KEPRLIINEPITDPQCGF--VNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIA 140
            ..|...:        ||.  |||...|...:.     :.....||..:|.  ..|....||:||.
Zfish   290 DSPSAAV--------CGIIPVNSSNGTVGGQN-----SSAVHWPWQASLY--WYSGQTCGGSLIN 339

  Fly   141 PHVVITAR-----QRTENMTASQLVVRAGEWDFSTKTEQLPS-VDVPIRSIVRHPGFNLENGANN 199
            ...|::|.     ||    ....|.|..|.   .|:.:..|| :...::::::||.:|.....|:
Zfish   340 KEWVLSAAHCFNGQR----NGFYLTVILGP---KTQNKYDPSRISRSVKAVIKHPYYNPNTNDND 397

  Fly   200 VALVFLRRSLTSSRHINPICMPSAPKNFDF-SRCIFTGWGKNSFDD---PSYMNVLKKISLPVVQ 260
            :|||.|...:|.:..|.|:|:.:....|:. :....|.| :|..|.   || ..:.:::.:||:.
Zfish   398 IALVRLSFPITFTDSIRPVCLAAEGSVFNSDTESWITTW-RNISDGVPLPS-PKIFQEVEVPVIG 460

  Fly   261 RRTCEQQLRLYYGNDFELDNSLMCAG-GEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVD 324
            .|.|    ...||.....|| ::||| .:.|||.|:||.|.|:   :.:....:..:|||:||..
Zfish   461 NRQC----NCLYGVGSITDN-MICAGLLKEGKDLCQGDSGGPM---VSNQSSVWVQSGIVSFGSG 517

  Fly   325 CGLPGVPAVYTNVANVIEWITLTTVNMPLPEEREEVPYASPTLSAGPYLNQWNQPNYEWLPTGYP 389
            |.....|.|||.|:...||||..|.:.|        |......|.|.      .|:|.:...|.|
Zfish   518 CAQSEFPGVYTRVSRYQEWITYFTCSDP--------PGFVQFTSTGA------DPDYCYSCPGRP 568

  Fly   390 ---NVNSIPWQLQEANNDLANSQYVRYY 414
               |.:::..|.::.:....:..|:..|
Zfish   569 LLCNASAVVEQQKQLSAASISHNYMLSY 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 68/241 (28%)
Tryp_SPc 113..344 CDD:238113 68/241 (28%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035 7/41 (17%)
Tryp_SPc 309..537 CDD:238113 68/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.