DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and Tpsab1

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:253 Identity:77/253 - (30%)
Similarity:123/253 - (48%) Gaps:27/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 REEDTGLAQEA---EVPWMVALLDARTS-SYVAGGALIAPHVVITARQRTENMTASQLVVRAGEW 166
            ||...| .|||   :.||.|:|....|. .:..||:||.|..|:||........|....||.   
Mouse    26 REGIVG-GQEAHGNKWPWQVSLRANDTYWMHFCGGSLIHPQWVLTAAHCVGPDVADPNKVRV--- 86

  Fly   167 DFSTKTEQLPSVD--VPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNF-D 228
              ..:.:.|...|  :.:..|:.||.|.:.....::||:.|...:..|.:::|:.:|.|.:.| .
Mouse    87 --QLRKQYLYYHDHLMTVSQIITHPDFYIVQDGADIALLKLTNPVNISDYVHPVPLPPASETFPS 149

  Fly   229 FSRCIFTGWGK--NSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYG-----NDFELDNSLMCAG 286
            .:.|..||||.  |..:.|... .||::.:|:::...|:  |:.:.|     |...:.:.::|||
Mouse   150 GTLCWVTGWGNIDNGVNLPPPF-PLKEVQVPIIENHLCD--LKYHKGLITGDNVHIVRDDMLCAG 211

  Fly   287 GEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            .| |.|||:||.|.||.|.::|.   :..||:|::|..|..|..|.:||.|...::||
Mouse   212 NE-GHDSCQGDSGGPLVCKVEDT---WLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 72/244 (30%)
Tryp_SPc 113..344 CDD:238113 72/244 (30%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 75/250 (30%)
Tryp_SPc 29..265 CDD:214473 73/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842905
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.