DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:250 Identity:71/250 - (28%)
Similarity:124/250 - (49%) Gaps:30/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQRTENMT-ASQLVVRAGE-----WDFSTKTEQLPS 177
            ||.|. :...::.:|.||::||.:.|::|.....|.: .|...:..|.     ::...|...:..
Zfish    44 PWQVD-IQMGSNGHVCGGSIIAKNWVLSAAHCFPNPSEVSAYTLYMGRHLLNGYNQFEKVSYVQR 107

  Fly   178 VDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSR---CIFTGWG- 238
            |.:|       .|:....|..:||||.||..::.:..|.|:|:|.|  :|.|:.   |..|||| 
Zfish   108 VVIP-------EGYTDPQGGRDVALVQLRAPVSWTDRIQPVCLPFA--DFQFNSGTLCYVTGWGH 163

  Fly   239 KNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELD--NSLMCAG-GEPGKDSCEGDGGS 300
            |......:....|:::.:|::.:.:|:...::...:...:|  :.::||| .|.|||||:||.|.
Zfish   164 KQEGVSLTGAAALREVEVPIIDQSSCQFMYQILSSDSSTVDILSDMICAGYKEGGKDSCQGDSGG 228

  Fly   301 PLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVNMPLPE 355
            ||.|.:.:.  .:..||:|:||:.|.....|.:|:.|:: .|.:..|||    ||
Zfish   229 PLVCPVGNG--TWIQAGVVSFGLGCAQKNRPGIYSRVSS-FEKLIRTTV----PE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 66/237 (28%)
Tryp_SPc 113..344 CDD:238113 66/237 (28%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 66/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587577
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.