DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and lrrc38b

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:XP_021335529.1 Gene:lrrc38b / 799882 ZFINID:ZDB-GENE-141216-65 Length:291 Species:Danio rerio


Alignment Length:248 Identity:75/248 - (30%)
Similarity:102/248 - (41%) Gaps:52/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LQCVTKPKMWLGLKQILLYVGLLLCVLLQVCRSKTQSQMFCPTVCHC-DLHAQRNRAVCSAKRLI 66
            |.||.:      |:.:|.   ||...||      ||.:. ||.:|.| |.|.    ..||.:.|.
Zfish     2 LPCVYR------LQPVLT---LLSFTLL------TQGEN-CPAICLCPDPHT----VDCSGRGLT 46

  Fly    67 SANIEIPTTVELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSY 131
            ....|||..|..|.|:.|.|..|..|..                 .||.|       |.||||..
Zfish    47 RLPDEIPLDVRRLLLADNWIPRIPSDFL-----------------VLYSD-------LVYLDLRN 87

  Fly   132 NRLEQIDEHILESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRN----SQVNQLGTQLLSA 192
            |.|..|:...|.::::|:.|:|..|.|:.:.||....|.||..|.|.|    |.||:   .....
Zfish    88 NSLSNIEPGTLSTSSRLVFLDLGCNNLTEIPKGTFGESRSLIKLRLGNNPYLSMVNE---DAFMG 149

  Fly   193 LPQLRQLDLAQNLLLTLSPGDFHAPRNLASLNVEENPFNCDRALAKVATGLRQ 245
            |..||:|:|.:|.|..|..|......:|..:.:|.||:.|:...|.:.|.|.:
Zfish   150 LTSLRELELERNALSGLQVGALSQLPSLRVVRLEGNPWVCNCNFANLFTWLEE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 16/59 (27%)
LRR_RI <76..230 CDD:238064 47/157 (30%)
leucine-rich repeat 76..99 CDD:275380 7/22 (32%)
leucine-rich repeat 100..123 CDD:275380 3/22 (14%)
LRR_8 122..182 CDD:290566 23/63 (37%)
leucine-rich repeat 124..147 CDD:275380 9/22 (41%)
leucine-rich repeat 148..171 CDD:275380 8/22 (36%)
LRR_8 170..230 CDD:290566 20/63 (32%)
leucine-rich repeat 172..195 CDD:275380 8/26 (31%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
lrrc38bXP_021335529.1 LRRNT 26..56 CDD:214470 12/33 (36%)
leucine-rich repeat 36..58 CDD:275380 8/25 (32%)
PLN00113 <43..>185 CDD:331614 50/168 (30%)
leucine-rich repeat 59..79 CDD:275380 8/36 (22%)
leucine-rich repeat 80..103 CDD:275380 9/22 (41%)
LRR_8 102..163 CDD:316378 22/63 (35%)
leucine-rich repeat 104..127 CDD:275380 8/22 (36%)
leucine-rich repeat 128..152 CDD:275380 8/26 (31%)
leucine-rich repeat 153..176 CDD:275380 8/22 (36%)
TPKR_C2 185..235 CDD:326558 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.