| Sequence 1: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001165952.1 | Gene: | Aspn / 66695 | MGIID: | 1913945 | Length: | 373 | Species: | Mus musculus |
| Alignment Length: | 251 | Identity: | 62/251 - (24%) |
|---|---|---|---|
| Similarity: | 105/251 - (41%) | Gaps: | 63/251 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 43 CPTVCHCDLHAQRNRAV-CSAKRLISANIEIPTTVELLDLSYNDITTIDDDSFKTTIHLLNLTLA 106
Fly 107 HNAIHTLYGDAFVELTRLRYLDLSYNRLEQI--------------DE----------------HI 141
Fly 142 LE------SNN----------QLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLL 190
Fly 191 SALPQLRQLDLAQNLLLTLSPGDF-HAPRNLASLNVEENPFNCDRALAKVATGLRQ 245 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 18/59 (31%) |
| LRR_RI | <76..230 | CDD:238064 | 46/200 (23%) | ||
| leucine-rich repeat | 76..99 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 122..182 | CDD:290566 | 23/105 (22%) | ||
| leucine-rich repeat | 124..147 | CDD:275380 | 14/68 (21%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 170..230 | CDD:290566 | 15/60 (25%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 7/23 (30%) | ||
| Aspn | NP_001165952.1 | LRRNT | 68..97 | CDD:214470 | 12/33 (36%) |
| leucine-rich repeat | 77..96 | CDD:275380 | 8/18 (44%) | ||
| LRR 1 | 96..117 | 6/20 (30%) | |||
| leucine-rich repeat | 97..120 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 98..155 | CDD:290566 | 18/56 (32%) | ||
| LRR 2 | 120..141 | 5/20 (25%) | |||
| leucine-rich repeat | 121..144 | CDD:275380 | 5/22 (23%) | ||
| LRR_RI | <139..333 | CDD:238064 | 39/175 (22%) | ||
| LRR 3 | 144..166 | 8/21 (38%) | |||
| leucine-rich repeat | 145..165 | CDD:275380 | 8/19 (42%) | ||
| Interaction with TGFB1 | 159..205 | 6/45 (13%) | |||
| leucine-rich repeat | 166..189 | CDD:275380 | 1/22 (5%) | ||
| LRR 5 | 189..212 | 5/22 (23%) | |||
| leucine-rich repeat | 190..215 | CDD:275380 | 5/24 (21%) | ||
| LRR_8 | 234..294 | CDD:290566 | 15/66 (23%) | ||
| LRR 6 | 235..255 | 3/19 (16%) | |||
| leucine-rich repeat | 236..259 | CDD:275380 | 4/22 (18%) | ||
| LRR 7 | 259..280 | 6/20 (30%) | |||
| leucine-rich repeat | 260..283 | CDD:275380 | 6/22 (27%) | ||
| LRR 8 | 283..305 | 7/28 (25%) | |||
| LRR 9 | 306..327 | ||||
| leucine-rich repeat | 307..331 | CDD:275380 | |||
| LRR 10 | 328..349 | ||||
| leucine-rich repeat | 332..359 | CDD:275380 | |||
| LRR 11 | 350..373 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||