| Sequence 1: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001073448.1 | Gene: | zgc:153913 / 559700 | ZFINID: | ZDB-GENE-061103-397 | Length: | 496 | Species: | Danio rerio |
| Alignment Length: | 260 | Identity: | 69/260 - (26%) |
|---|---|---|---|
| Similarity: | 105/260 - (40%) | Gaps: | 71/260 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 18 ILLYVGLLLCVLLQVCRSKTQSQMFCPTVCHCDLHAQRNRAVCSAKRLISANIEIPTTVELLDLS 82
Fly 83 YNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLS----------------- 130
Fly 131 --------YNRLEQIDEHILESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGT 187
Fly 188 QL------------------------LSALPQLRQLDLAQNLLLTLSPGDFHAPRNLASLNVEEN 228
Fly 229 228 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 19/84 (23%) |
| LRR_RI | <76..230 | CDD:238064 | 52/202 (26%) | ||
| leucine-rich repeat | 76..99 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 122..182 | CDD:290566 | 21/84 (25%) | ||
| leucine-rich repeat | 124..147 | CDD:275380 | 8/47 (17%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 170..230 | CDD:290566 | 21/83 (25%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 8/46 (17%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 10/22 (45%) | ||
| zgc:153913 | NP_001073448.1 | leucine-rich repeat | 75..98 | CDD:275380 | 6/22 (27%) |
| LRR_RI | 141..>350 | CDD:238064 | 32/112 (29%) | ||
| LRR_8 | 147..206 | CDD:290566 | 17/58 (29%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 194..252 | CDD:290566 | 14/59 (24%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 1/22 (5%) | ||
| leucine-rich repeat | 220..241 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 242..265 | CDD:275380 | 3/9 (33%) | ||
| leucine-rich repeat | 266..289 | CDD:275380 | |||
| LRR_8 | 267..324 | CDD:290566 | |||
| leucine-rich repeat | 290..313 | CDD:275380 | |||
| leucine-rich repeat | 314..337 | CDD:275380 | |||
| leucine-rich repeat | 338..359 | CDD:275380 | |||
| TPKR_C2 | 370..>404 | CDD:301599 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||