| Sequence 1: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001122166.1 | Gene: | lrit3a / 558559 | ZFINID: | ZDB-GENE-080723-63 | Length: | 636 | Species: | Danio rerio |
| Alignment Length: | 246 | Identity: | 63/246 - (25%) |
|---|---|---|---|
| Similarity: | 110/246 - (44%) | Gaps: | 43/246 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 24 LLLCVLLQVCRSKTQSQMFCPTVCHCDLHAQRNRAVCSAKRLISAN----IEIPTTVELLDLSYN 84
Fly 85 DITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHILESNNQLI 149
Fly 150 HLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLLTLSPGD- 213
Fly 214 ------FHAPRNLAS------LNVEENPFNCDRALAKVATGLRQRGVAIFM 252 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 15/59 (25%) |
| LRR_RI | <76..230 | CDD:238064 | 41/166 (25%) | ||
| leucine-rich repeat | 76..99 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 122..182 | CDD:290566 | 19/59 (32%) | ||
| leucine-rich repeat | 124..147 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 170..230 | CDD:290566 | 19/72 (26%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 9/29 (31%) | ||
| lrit3a | NP_001122166.1 | LRR_8 | 81..141 | CDD:290566 | 19/59 (32%) |
| leucine-rich repeat | 83..106 | CDD:275378 | 7/22 (32%) | ||
| LRR_4 | 107..145 | CDD:289563 | 12/37 (32%) | ||
| leucine-rich repeat | 107..130 | CDD:275378 | 6/22 (27%) | ||
| LRR_8 | 129..>171 | CDD:290566 | 14/42 (33%) | ||
| LRR_4 | 129..170 | CDD:289563 | 13/41 (32%) | ||
| leucine-rich repeat | 131..154 | CDD:275378 | 5/22 (23%) | ||
| leucine-rich repeat | 155..168 | CDD:275378 | 4/12 (33%) | ||
| TPKR_C2 | 199..249 | CDD:301599 | 6/25 (24%) | ||
| Ig | 252..343 | CDD:299845 | |||
| IG_like | 261..343 | CDD:214653 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||