Sequence 1: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005036.1 | Gene: | vasn / 448556 | XenbaseID: | XB-GENE-941552 | Length: | 661 | Species: | Xenopus tropicalis |
Alignment Length: | 393 | Identity: | 93/393 - (23%) |
---|---|---|---|
Similarity: | 145/393 - (36%) | Gaps: | 142/393 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 MWLGLKQILLYVGLLLCVLLQVCRSKTQSQMF---CPTVCHCDLHAQRNRAVCSAKRLISANIEI 72
Fly 73 PTTV----------------------------ELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNA 109
Fly 110 IHTLYGDAFVELTRLRYLDLSYNRLEQID-------EHILE---SNNQLI--------HL----- 151
Fly 152 ----------------NLEGNKLSTLGKGPILRS-----PSLRSLNLRNSQV------------- 182
Fly 183 --------NQLGTQLLSALPQLRQLDLAQNLLLTLSPGDFHAPRNLASLNVEENPFNCDRALAKV 239
Fly 240 ATGLRQRGVAIFMSNCMEEEVQDHQDDAEAVNFPNKN-----EKFESMEY--------LEPSTRG 291
Fly 292 PQS 294 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 21/87 (24%) |
LRR_RI | <76..230 | CDD:238064 | 58/246 (24%) | ||
leucine-rich repeat | 76..99 | CDD:275380 | 8/50 (16%) | ||
leucine-rich repeat | 100..123 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 122..182 | CDD:290566 | 25/103 (24%) | ||
leucine-rich repeat | 124..147 | CDD:275380 | 11/32 (34%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 8/56 (14%) | ||
LRR_8 | 170..230 | CDD:290566 | 20/80 (25%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 8/43 (19%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 9/22 (41%) | ||
vasn | NP_001005036.1 | LRRNT | 21..52 | CDD:214470 | 9/37 (24%) |
leucine-rich repeat | 52..75 | CDD:275380 | 0/22 (0%) | ||
LRR 1 | 52..72 | 0/19 (0%) | |||
LRR | <60..>276 | CDD:227223 | 53/215 (25%) | ||
LRR 2 | 75..96 | 7/20 (35%) | |||
leucine-rich repeat | 76..99 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 99..158 | CDD:338972 | 21/58 (36%) | ||
LRR 3 | 99..120 | 7/20 (35%) | |||
leucine-rich repeat | 100..123 | CDD:275380 | 8/22 (36%) | ||
LRR 4 | 123..144 | 7/20 (35%) | |||
leucine-rich repeat | 124..147 | CDD:275380 | 6/22 (27%) | ||
LRR 5 | 147..168 | 7/20 (35%) | |||
leucine-rich repeat | 148..169 | CDD:275380 | 7/20 (35%) | ||
LRR 6 | 169..189 | 1/19 (5%) | |||
leucine-rich repeat | 170..191 | CDD:275380 | 0/20 (0%) | ||
LRR 7 | 191..212 | 5/20 (25%) | |||
leucine-rich repeat | 192..215 | CDD:275380 | 4/22 (18%) | ||
LRR 8 | 215..237 | 4/21 (19%) | |||
leucine-rich repeat | 216..235 | CDD:275380 | 4/18 (22%) | ||
leucine-rich repeat | 236..260 | CDD:275380 | 4/23 (17%) | ||
LRR 9 | 238..258 | 3/19 (16%) | |||
LRR 10 | 259..281 | 10/21 (48%) | |||
leucine-rich repeat | 261..281 | CDD:275380 | 9/19 (47%) | ||
PCC | 265..>344 | CDD:188093 | 24/90 (27%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 348..395 | 4/13 (31%) | |||
EGF | 407..438 | CDD:333761 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 591..661 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |