DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and Tollo

DIOPT Version :10

Sequence 1:NP_609761.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster


Alignment Length:184 Identity:47/184 - (25%)
Similarity:93/184 - (50%) Gaps:7/184 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHIL 142
            :||||.|.|:.::...|:....|..|.|..|.|..|.|..|.:||.|..|.||.||:..|::..|
  Fly   336 MLDLSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIFADLTNLHTLILSRNRISVIEQRTL 400

  Fly   143 ESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLL 207
            :....|:.|:|:.|::|.:.:..::....|:.|:|.:::: |...:.|:.:..|:.||:.:|::.
  Fly   401 QGLKNLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNKL-QAVPEALAHVQLLKTLDVGENMIS 464

  Fly   208 TLSPGDFHAPRNLASLNVEENPFNCDRALAKVATGLRQRGVAIFMSNCMEEEVQ 261
            .:.........:|..|.:.||      :|..:..|:..|..::.:.|..:.:::
  Fly   465 QIENTSITQLESLYGLRMTEN------SLTHIRRGVFDRMSSLQILNLSQNKLK 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_609761.1 LRR <66..>230 CDD:443914 43/151 (28%)
leucine-rich repeat 76..99 CDD:275380 7/20 (35%)
leucine-rich repeat 100..123 CDD:275380 9/22 (41%)
leucine-rich repeat 124..147 CDD:275380 8/22 (36%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
leucine-rich repeat 172..195 CDD:275380 5/22 (23%)
leucine-rich repeat 196..219 CDD:275380 4/22 (18%)
TolloNP_524757.1 LRR 54..400 CDD:443914 24/63 (38%)
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380
LRR 239..634 CDD:443914 47/184 (26%)
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..333 CDD:275380
leucine-rich repeat 334..357 CDD:275380 7/20 (35%)
leucine-rich repeat 358..381 CDD:275380 9/22 (41%)
leucine-rich repeat 382..405 CDD:275380 8/22 (36%)
leucine-rich repeat 406..429 CDD:275380 5/22 (23%)
leucine-rich repeat 430..452 CDD:275380 5/22 (23%)
leucine-rich repeat 453..500 CDD:275380 11/52 (21%)
leucine-rich repeat 501..521 CDD:275380 1/12 (8%)
leucine-rich repeat 525..547 CDD:275380
leucine-rich repeat 548..573 CDD:275380
leucine-rich repeat 604..640 CDD:275380
LRR_8 616..>660 CDD:404697
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR <794..>920 CDD:443914
leucine-rich repeat 817..864 CDD:275380
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.