| Sequence 1: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001005214.2 | Gene: | LRRC52 / 440699 | HGNCID: | 32156 | Length: | 313 | Species: | Homo sapiens |
| Alignment Length: | 269 | Identity: | 68/269 - (25%) |
|---|---|---|---|
| Similarity: | 103/269 - (38%) | Gaps: | 50/269 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 43 CPTVCHCDLHAQRNRAVCSAKRLISANIEIPTTVELLDLSYNDITTIDDDSFKTTIHLLNLTLAH 107
Fly 108 NAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHILESNNQLIHLNLEGN-KLSTLGKGPILRSPS 171
Fly 172 LRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQN---------------LLLTLSPG-DFHA---- 216
Fly 217 PRNLASLNVEE--NPFN--------------------CDRALAKVATGLRQRGV-AIFMSNCMEE 258
Fly 259 EVQDHQDDA 267 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 17/59 (29%) |
| LRR_RI | <76..230 | CDD:238064 | 46/176 (26%) | ||
| leucine-rich repeat | 76..99 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 122..182 | CDD:290566 | 23/60 (38%) | ||
| leucine-rich repeat | 124..147 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 7/23 (30%) | ||
| LRR_8 | 170..230 | CDD:290566 | 20/81 (25%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 8/42 (19%) | ||
| LRRC52 | NP_001005214.2 | PRK15387 | <2..>93 | CDD:185285 | 19/70 (27%) |
| LRRNT | 26..55 | CDD:214470 | 10/32 (31%) | ||
| leucine-rich repeat | 35..54 | CDD:275380 | 5/18 (28%) | ||
| LRR 1 | 54..75 | 5/20 (25%) | |||
| leucine-rich repeat | 55..78 | CDD:275380 | 5/22 (23%) | ||
| LRR 2 | 78..99 | 5/20 (25%) | |||
| LRR_8 | 79..136 | CDD:338972 | 17/56 (30%) | ||
| leucine-rich repeat | 79..102 | CDD:275380 | 5/22 (23%) | ||
| LRR 3 | 102..123 | 9/20 (45%) | |||
| leucine-rich repeat | 103..126 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 126..185 | CDD:338972 | 20/58 (34%) | ||
| LRR 4 | 126..148 | 7/21 (33%) | |||
| leucine-rich repeat | 127..151 | CDD:275380 | 7/23 (30%) | ||
| LRR 5 | 151..172 | 9/20 (45%) | |||
| leucine-rich repeat | 152..175 | CDD:275380 | 9/22 (41%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||