DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and cDIP

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster


Alignment Length:387 Identity:91/387 - (23%)
Similarity:155/387 - (40%) Gaps:73/387 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHIL 142
            :|.||.|.|..:...:|:...:|..:.|..|.:..|...||..|.:|:||||:.||||.:...:.
  Fly   145 ILLLSDNHIEVLPTKTFRGAGNLEFIFLNRNKLGKLQAGAFDNLLKLQYLDLTENRLEALAADVF 209

  Fly   143 ESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSAL---PQLRQLDLAQN 204
            .....|.|:.|.||:|:|:.......:|.|.|:.::|:::.::|.....:.   .|::.:||:.|
  Fly   210 AGLKSLRHVGLAGNQLTTIESDLFAHNPDLLSVAMQNNRLREVGEYAFRSRGRHHQMQYVDLSNN 274

  Fly   205 -----LLLTLSPGDFHAPRN----------------LASLNVEENPFNCDRALAKVATGLRQRGV 248
                 |||.::..:..| ||                |:...|.|..|....||..:.  ||...:
  Fly   275 PELVVLLLNINATNLTA-RNCSLDRVNLYGSVTNVDLSDNRVRELYFPASEALEHLV--LRNNSL 336

  Fly   249 AIFMSNCMEEEVQDHQDDAEAVNFPNKNEKFESMEYLEPSTRGPQSVLSVWRDLDSSE------- 306
            ....|......:: |.|.|:.   ||..:       |....|.|...:.|.|:....|       
  Fly   337 VQLASLSRVPRLR-HLDVADN---PNLGQ-------LPDGWRTPHLEMLVLRNTGQMELPLEALQ 390

  Fly   307 -EQNSSQDDEQMSSLSDVCEGSREKLCLRYRICLERVSHELLAGGN------SQLEDEIIRTH-- 362
             .||..:.|...::|:::...:..        .|.:::|..:.|.|      ..:.|.:||.:  
  Fly   391 GMQNLQKLDISGNNLTEIDPSAFP--------TLTQLTHFYIHGNNWNCFSLRNIMDVLIRANGI 447

  Fly   363 TYDEDDLKLAFVVGGATGV-CMVIFIITFALCLKSCCEMRKKKSNPEVATGV-SAPLNPSQD 422
            .|..|:....|......|: ||      :.|..|   |.....|:.|::..| |:|:..|.|
  Fly   448 AYTVDNYDPDFPGEYFHGIACM------YRLPEK---EGVDSSSSSEISASVESSPITSSSD 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 19/55 (35%)
LRR_RI <76..230 CDD:238064 47/175 (27%)
leucine-rich repeat 76..99 CDD:275380 6/20 (30%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
LRR_8 122..182 CDD:290566 20/59 (34%)
leucine-rich repeat 124..147 CDD:275380 9/22 (41%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
LRR_8 170..230 CDD:290566 18/83 (22%)
leucine-rich repeat 172..195 CDD:275380 4/25 (16%)
leucine-rich repeat 196..219 CDD:275380 7/27 (26%)
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380
LRR_RI 143..407 CDD:238064 68/275 (25%)
leucine-rich repeat 143..166 CDD:275380 6/20 (30%)
LRR_8 166..225 CDD:290566 21/58 (36%)
leucine-rich repeat 167..190 CDD:275380 7/22 (32%)
leucine-rich repeat 191..214 CDD:275380 9/22 (41%)
leucine-rich repeat 215..238 CDD:275380 7/22 (32%)
leucine-rich repeat 239..265 CDD:275380 4/25 (16%)
leucine-rich repeat 266..325 CDD:275380 13/59 (22%)
LRR_8 304..357 CDD:290566 12/58 (21%)
leucine-rich repeat 326..347 CDD:275380 4/22 (18%)
leucine-rich repeat 348..394 CDD:275380 11/56 (20%)
LRR_8 369..428 CDD:290566 11/66 (17%)
LRR_4 393..433 CDD:289563 8/47 (17%)
leucine-rich repeat 395..418 CDD:275380 3/30 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.