DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and CG18249

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001163549.1 Gene:CG18249 / 40964 FlyBaseID:FBgn0037553 Length:559 Species:Drosophila melanogaster


Alignment Length:163 Identity:45/163 - (27%)
Similarity:76/163 - (46%) Gaps:15/163 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CSAKRLISANIEIPTTVELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRL 124
            |:...:...::.....:..|.:....:..:.|..|.....|..|.|:.|.|||::..||..|::|
  Fly    89 CATYHISKESLRPVENLTSLQMQGTSLGVLRDQIFNAVPRLEILQLSQNFIHTVHVAAFQGLSKL 153

  Fly   125 RYLDLSYNRLEQIDEHILESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQL 189
            |.|.|..|.:.:|....|:...:|:||:|..|:|:||.:....::..|::|.|..:.:..|...:
  Fly   154 RLLGLQGNAIAEILSSTLDPLMELVHLDLSRNELTTLPQNIFAKNKKLQTLLLNGNPLRILMPDV 218

  Fly   190 LSALPQLRQLDL---------------AQNLLL 207
            |.:||.||.|||               .|||:|
  Fly   219 LGSLPNLRLLDLGHAAELEVMTLNLTNVQNLVL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 18/59 (31%)
LRR_RI <76..230 CDD:238064 44/147 (30%)
leucine-rich repeat 76..99 CDD:275380 3/22 (14%)
leucine-rich repeat 100..123 CDD:275380 10/22 (45%)
LRR_8 122..182 CDD:290566 18/59 (31%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
leucine-rich repeat 148..171 CDD:275380 8/22 (36%)
LRR_8 170..230 CDD:290566 16/53 (30%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 9/27 (33%)
CG18249NP_001163549.1 leucine-rich repeat 57..80 CDD:275380
LRR_8 104..163 CDD:290566 18/58 (31%)
leucine-rich repeat 105..128 CDD:275380 3/22 (14%)
LRR_RI 107..438 CDD:238064 44/145 (30%)
leucine-rich repeat 129..152 CDD:275380 10/22 (45%)
leucine-rich repeat 153..176 CDD:275380 7/22 (32%)
LRR_8 176..232 CDD:290566 20/55 (36%)
leucine-rich repeat 177..200 CDD:275380 8/22 (36%)
leucine-rich repeat 201..224 CDD:275380 6/22 (27%)
leucine-rich repeat 225..258 CDD:275380 9/27 (33%)
leucine-rich repeat 259..310 CDD:275380
leucine-rich repeat 311..344 CDD:275380
LRR_8 343..403 CDD:290566
leucine-rich repeat 345..368 CDD:275380
leucine-rich repeat 369..390 CDD:275380
leucine-rich repeat 393..417 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.