Sequence 1: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649770.1 | Gene: | CG7800 / 40963 | FlyBaseID: | FBgn0037552 | Length: | 533 | Species: | Drosophila melanogaster |
Alignment Length: | 220 | Identity: | 57/220 - (25%) |
---|---|---|---|
Similarity: | 86/220 - (39%) | Gaps: | 68/220 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 VELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEH 140
Fly 141 ILESNNQLIHLNLEGNKL-------------------STLGKGPILRSPSLRSLNLRNSQVNQLG 186
Fly 187 -----------------------------------------TQLLSALPQLRQLDLAQNLL-LTL 209
Fly 210 SPGD------FHAPRNLASLNVEEN 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 22/57 (39%) |
LRR_RI | <76..230 | CDD:238064 | 57/220 (26%) | ||
leucine-rich repeat | 76..99 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 100..123 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 122..182 | CDD:290566 | 25/78 (32%) | ||
leucine-rich repeat | 124..147 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 10/41 (24%) | ||
LRR_8 | 170..230 | CDD:290566 | 21/107 (20%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 8/63 (13%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 8/29 (28%) | ||
CG7800 | NP_649770.1 | leucine-rich repeat | 46..64 | CDD:275380 | |
leucine-rich repeat | 65..85 | CDD:275380 | |||
LRR_8 | 87..147 | CDD:290566 | 11/33 (33%) | ||
leucine-rich repeat | 89..112 | CDD:275380 | |||
leucine-rich repeat | 113..136 | CDD:275380 | 7/22 (32%) | ||
LRR_RI | <131..334 | CDD:238064 | 52/202 (26%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 140..195 | CDD:290566 | 23/54 (43%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 209..246 | CDD:275380 | 11/36 (31%) | ||
leucine-rich repeat | 247..267 | CDD:275380 | 0/19 (0%) | ||
leucine-rich repeat | 268..292 | CDD:275380 | 2/23 (9%) | ||
leucine-rich repeat | 293..322 | CDD:275380 | 8/29 (28%) | ||
leucine-rich repeat | 395..406 | CDD:275378 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45453798 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |