DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and rtn4r

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_982345.1 Gene:rtn4r / 403306 ZFINID:ZDB-GENE-040310-1 Length:479 Species:Danio rerio


Alignment Length:504 Identity:110/504 - (21%)
Similarity:175/504 - (34%) Gaps:152/504 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LKQILLYVGLLLCV-----LLQVCRSKTQSQMFCPTVCHCDLHAQRNRAV-CSAKRLISANIEIP 73
            :|.:::..|.|||:     |:.|..|       ||..|.|  :::....| |..:.|.|...|||
Zfish     1 MKTLIVEGGRLLCLMFWLNLVPVINS-------CPAKCVC--YSEPKATVACQQQGLFSIPTEIP 56

  Fly    74 TTVELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNR----- 133
            ...:.:.|..|.:|.:...||.:..:|..|.:..|.|..:...||..|.||..||:..|.     
Zfish    57 VRSQRIFLQSNKLTVVRSTSFSSVHNLTVLWMYSNNISHIEAGAFYGLERLEELDIGDNSNLRII 121

  Fly   134 --------------------LEQIDEHILESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLR 178
                                |.::...:......|.:|.|:.|.|..|.:...|...:|..|.|.
Zfish   122 SPTAFRGLTKLHTLHLHRCGLSELPVGVFRGLFSLQYLYLQDNNLLALHEDTFLDLANLTYLFLH 186

  Fly   179 NSQVNQLGTQLLSALPQLRQLDLAQNLL-----------------------LTLSPGDFHAPR-N 219
            |:::..:...:|..|..|.:|.|.||.:                       ||:..|:...|. :
Zfish   187 NNKIKVVTDHMLRGLVNLDRLLLHQNRIVHVQQQAFNDLSKLTTLFLFFNNLTMLTGESMNPLVS 251

  Fly   220 LASLNVEENPFNCD-RALAKVATGLRQRGVAIFMSNCMEEEVQDH--------------QDDAE- 268
            |..|.:..|.:.|| ||........|.:|        ...:::.|              .||.| 
Zfish   252 LQYLRLNGNQWICDCRARPLWDWFKRFKG--------SSSDLECHLPASLNGKDLKRLKSDDLEG 308

  Fly   269 AVNFPNK------NEKFESMEYL---EPSTRG-PQSVLSVWRDLDSS------------------ 305
            .|:.|::      |.|..|.::|   :|.... |:..||   |.|.|                  
Zfish   309 CVDSPSQVQTSIFNSKVHSGKFLSLDDPLVESIPRCCLS---DNDKSSIISSKSIPDPSSYNSRQ 370

  Fly   306 -------EEQNSSQ-----------DDEQMSSLSDVCEGSREKLCLRYRICLERVSHELLAGGN- 351
                   |::|.|:           :.....||:|   |....:.......|:|:..|||  || 
Zfish   371 ITNNPLKEKENISKTKFREVERTKNETRNKQSLND---GPLGTMSNNLDQSLDRIDPELL--GNL 430

  Fly   352 ------SQLEDEIIRTHTYDEDDLKLAFVVGGATGVCMVIFIITFALCL 394
                  ::.:.:..:....|::.||   ..|....|..|||:..|.|.|
Zfish   431 EPSTAPTKKKKKCSKKPKSDQNCLK---GHGSTIQVLAVIFLPLFWLSL 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 17/84 (20%)
LRR_RI <76..230 CDD:238064 43/202 (21%)
leucine-rich repeat 76..99 CDD:275380 5/22 (23%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
LRR_8 122..182 CDD:290566 17/84 (20%)
leucine-rich repeat 124..147 CDD:275380 5/47 (11%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
LRR_8 170..230 CDD:290566 18/83 (22%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 9/46 (20%)
rtn4rNP_982345.1 leucine-rich repeat 40..57 CDD:275380 6/16 (38%)
LRR_8 60..115 CDD:290566 16/54 (30%)
leucine-rich repeat 60..82 CDD:275380 5/21 (24%)
leucine-rich repeat 83..106 CDD:275380 7/22 (32%)
leucine-rich repeat 107..131 CDD:275380 4/23 (17%)
leucine-rich repeat 132..155 CDD:275380 1/22 (5%)
LRR_8 155..214 CDD:290566 18/58 (31%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..203 CDD:275380 6/22 (27%)
LRR_8 203..261 CDD:290566 11/57 (19%)
leucine-rich repeat 204..227 CDD:275380 5/22 (23%)
leucine-rich repeat 228..251 CDD:275380 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.