DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and Toll-6

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster


Alignment Length:302 Identity:70/302 - (23%)
Similarity:114/302 - (37%) Gaps:109/302 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHIL 142
            ||:||:|.:|.::.:.|.....|..|.|.||.:..:..|.|..:..|..|.||:|:|:.:|.:.|
  Fly   404 LLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLLSHNKLKYLDAYAL 468

  Fly   143 E----------SNNQLI--------------HLNLEGNKLSTLGKGPI-LRS-PSLRSLNLRNSQ 181
            .          .||.||              .|||.||:|.|:   |: ||: ..||:::|..:.
  Fly   469 NGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGNQLKTV---PLALRNMRHLRTVDLGENM 530

  Fly   182 V------------NQLGTQLLS------------ALPQLRQLDLAQNLLLTLSPGDFHAPRNLAS 222
            :            |..|.:|:.            .||.|:.|:||:|.:..:.||.|....::.:
  Fly   531 ITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQA 595

  Fly   223 LNVEENPFNCDRALAKVATGLRQRGVAIFMSNCMEEEVQDHQDDAEAVNFPN------KNEKFES 281
            :.::.|..|....|..                                |.|:      .:.:.||
  Fly   596 VRLDGNELNDINGLFS--------------------------------NMPSLLWLNISDNRLES 628

  Fly   282 MEYLE-PSTRGPQSVLSVWRDLDSSEEQNSSQDDEQMSSLSD 322
            .:|.. |||       ..|.||..:          ::||||:
  Fly   629 FDYGHVPST-------LQWLDLHKN----------RLSSLSN 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 19/55 (35%)
LRR_RI <76..230 CDD:238064 53/201 (26%)
leucine-rich repeat 76..99 CDD:275380 7/20 (35%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
LRR_8 122..182 CDD:290566 25/85 (29%)
leucine-rich repeat 124..147 CDD:275380 9/32 (28%)
leucine-rich repeat 148..171 CDD:275380 12/38 (32%)
LRR_8 170..230 CDD:290566 17/83 (20%)
leucine-rich repeat 172..195 CDD:275380 7/46 (15%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380
LRR_8 171..236 CDD:290566
leucine-rich repeat 172..201 CDD:275380
leucine-rich repeat 202..278 CDD:275380
leucine-rich repeat 229..249 CDD:275380
LRR_RI 278..468 CDD:238064 21/63 (33%)
leucine-rich repeat 279..302 CDD:275380
LRR_8 301..386 CDD:290566
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..350 CDD:275380
LRR 350..729 CDD:227223 70/302 (23%)
leucine-rich repeat 352..375 CDD:275380
leucine-rich repeat 376..401 CDD:275380
LRR_RI <401..626 CDD:238064 57/256 (22%)
leucine-rich repeat 402..425 CDD:275380 7/20 (35%)
leucine-rich repeat 426..449 CDD:275380 7/22 (32%)
leucine-rich repeat 450..473 CDD:275380 8/22 (36%)
leucine-rich repeat 474..497 CDD:275380 4/22 (18%)
leucine-rich repeat 498..518 CDD:275380 10/22 (45%)
leucine-rich repeat 521..544 CDD:275380 3/22 (14%)
leucine-rich repeat 545..566 CDD:275380 2/20 (10%)
leucine-rich repeat 569..592 CDD:275380 8/22 (36%)
leucine-rich repeat 593..615 CDD:275380 4/53 (8%)
leucine-rich repeat 616..637 CDD:275380 4/20 (20%)
leucine-rich repeat 638..662 CDD:275380 7/26 (27%)
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.