| Sequence 1: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_957357.1 | Gene: | chad / 394038 | ZFINID: | ZDB-GENE-040426-1130 | Length: | 363 | Species: | Danio rerio |
| Alignment Length: | 216 | Identity: | 67/216 - (31%) |
|---|---|---|---|
| Similarity: | 100/216 - (46%) | Gaps: | 24/216 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 24 LLLCVLLQVC-----RSKTQSQMFCPTVCHCDLHAQRNRAVCSAKRLISANI---EIPTTVE--- 77
Fly 78 LLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHIL 142
Fly 143 ESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLL 207
Fly 208 TLSPGDFHAPRNLASLNVEEN 228 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 22/62 (35%) |
| LRR_RI | <76..230 | CDD:238064 | 49/156 (31%) | ||
| leucine-rich repeat | 76..99 | CDD:275380 | 6/25 (24%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 10/22 (45%) | ||
| LRR_8 | 122..182 | CDD:290566 | 20/59 (34%) | ||
| leucine-rich repeat | 124..147 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 170..230 | CDD:290566 | 17/59 (29%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 7/22 (32%) | ||
| chad | NP_957357.1 | LRRNT | 26..52 | CDD:279764 | 10/38 (26%) |
| leucine-rich repeat | 57..80 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 79..139 | CDD:290566 | 23/59 (39%) | ||
| leucine-rich repeat | 81..104 | CDD:275380 | 10/22 (45%) | ||
| LRR_RI | <96..304 | CDD:238064 | 37/114 (32%) | ||
| LRR_4 | 104..143 | CDD:289563 | 13/38 (34%) | ||
| leucine-rich repeat | 105..128 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 127..187 | CDD:290566 | 17/59 (29%) | ||
| leucine-rich repeat | 129..152 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 153..176 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 177..235 | CDD:290566 | 12/33 (36%) | ||
| leucine-rich repeat | 177..200 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 201..224 | CDD:275380 | 4/9 (44%) | ||
| LRR_8 | 225..284 | CDD:290566 | |||
| leucine-rich repeat | 225..248 | CDD:275380 | |||
| leucine-rich repeat | 250..273 | CDD:275380 | |||
| LRRCT | 304..351 | CDD:214507 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||