DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and CG32055

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_729599.1 Gene:CG32055 / 39188 FlyBaseID:FBgn0052055 Length:534 Species:Drosophila melanogaster


Alignment Length:331 Identity:80/331 - (24%)
Similarity:123/331 - (37%) Gaps:104/331 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LHAQRNRAVCSAKRLISANIEIPTTVELLDLSYNDITTIDDDSF------KT---------TIH- 99
            |:...|......:.|..|..|| ..:||||.|.|.:..:||..|      :|         .|| 
  Fly   244 LNVSNNNLFEIKRTLFMAPGEI-APLELLDYSSNIVKVLDDSVFCRLKKLRTLNLWLNQINRIHP 307

  Fly   100 --------LLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQI-----DEHILESNNQLIHL 151
                    |..|.|..|.|..|..|.|..||.|..||||.|.::::     .|.||   .:||:|
  Fly   308 RAFLGLSSLQTLHLQGNKISILPDDVFANLTALEKLDLSKNNIQKLGLRVFGERIL---RKLIYL 369

  Fly   152 NLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLL---------- 206
            :|..|.::.|....:...|.::.|.||.:::..|..::.:.|.||:.|.:.:|.|          
  Fly   370 DLSNNYIADLHPLALSSMPFIKELRLRRNRLVSLDLRMFAPLRQLQLLTINENRLEEIDGEILDT 434

  Fly   207 -------------LTLSPGDFHAPRNLASL---NVEENPFNCDRALAKVATGLRQRGVAIFMSNC 255
                         ||..| |..:.:||..|   .:|.||:.| ..|.::.:.|..|.|:      
  Fly   435 LDRLNHLELNNNRLTFLP-DLKSSQNLLQLRNITLEGNPWQC-LCLDEITSWLNGRHVS------ 491

  Fly   256 MEEEVQDHQDDAEAVNFPNKNEKFESMEYLEPST-----RGPQSVLS----VWRDLDSSEEQNSS 311
                                        |..||:     |.|..|::    ..|||..::.|...
  Fly   492 ----------------------------YARPSSAYFSGRKPLCVVTPMDKCLRDLQETKAQGIV 528

  Fly   312 QDDEQM 317
            :..|::
  Fly   529 ESYEKI 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 28/83 (34%)
LRR_RI <76..230 CDD:238064 57/208 (27%)
leucine-rich repeat 76..99 CDD:275380 10/37 (27%)
leucine-rich repeat 100..123 CDD:275380 9/22 (41%)
LRR_8 122..182 CDD:290566 20/64 (31%)
leucine-rich repeat 124..147 CDD:275380 9/27 (33%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
LRR_8 170..230 CDD:290566 20/85 (24%)
leucine-rich repeat 172..195 CDD:275380 5/22 (23%)
leucine-rich repeat 196..219 CDD:275380 8/45 (18%)
CG32055NP_729599.1 leucine-rich repeat 76..99 CDD:275380
leucine-rich repeat 100..123 CDD:275380
LRR_8 128..180 CDD:290566
leucine-rich repeat 128..147 CDD:275380
leucine-rich repeat 148..171 CDD:275380
leucine-rich repeat 172..192 CDD:275380
LRR_RI <187..400 CDD:238064 47/159 (30%)
LRR_8 192..251 CDD:290566 2/6 (33%)
leucine-rich repeat 193..216 CDD:275380
leucine-rich repeat 217..240 CDD:275380
leucine-rich repeat 241..267 CDD:275380 6/23 (26%)
leucine-rich repeat 268..291 CDD:275380 9/22 (41%)
LRR_8 290..350 CDD:290566 19/59 (32%)
leucine-rich repeat 292..315 CDD:275380 3/22 (14%)
leucine-rich repeat 316..339 CDD:275380 9/22 (41%)
LRR_8 340..400 CDD:290566 19/62 (31%)
leucine-rich repeat 340..365 CDD:275380 9/27 (33%)
leucine-rich repeat 366..389 CDD:275380 6/22 (27%)
leucine-rich repeat 390..413 CDD:275380 5/22 (23%)
LRR_8 391..448 CDD:290566 10/56 (18%)
leucine-rich repeat 414..437 CDD:275380 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453561
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.