DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and LRRC26

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001013675.1 Gene:LRRC26 / 389816 HGNCID:31409 Length:334 Species:Homo sapiens


Alignment Length:420 Identity:94/420 - (22%)
Similarity:146/420 - (34%) Gaps:134/420 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLLCVLL-------QVCRSKTQSQMF----CPTVCHCDLHAQRNRAVCSAKRLISANIEIPTTVE 77
            |||.:||       ||..:.:.|...    ||.||.|   .....|.|||..|.:....:...:.
Human    13 LLLLLLLSPWPVWAQVSATASPSGSLGAPDCPEVCTC---VPGGLASCSALSLPAVPPGLSLRLR 74

  Fly    78 LLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHIL 142
            .|.|.:|.:..:...:|.....|..|.|..|.:|:::..||..|..|:.||||.|:||       
Human    75 ALLLDHNRVRALPPGAFAGAGALQRLDLRENGLHSVHVRAFWGLGALQLLDLSANQLE------- 132

  Fly   143 ESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLL 207
                             .|..|......:||:|:|..:::.:|....|.|||.||.|.|..|.|.
Human   133 -----------------ALAPGTFAPLRALRNLSLAGNRLARLEPAALGALPLLRSLSLQDNELA 180

  Fly   208 TLSPGDFHAPRNLASLNVEENPFNCDRALAKVATGLRQRGVAIFMSNCMEEEVQDHQDDAEAVNF 272
            .|:||.......|.:|::..||:.|..||..:...||:..:                        
Human   181 ALAPGLLGRLPALDALHLRGNPWGCGCALRPLCAWLRRHPL------------------------ 221

  Fly   273 PNKNEKFESMEYLEPSTRGPQSVLSVWRD-LDSSEEQNSSQDDEQMSSLSDVC-EGSREKLCLRY 335
                          |::.. ::||.||.. |..|          .:::.||.. ....:.|.|| 
Human   222 --------------PASEA-ETVLCVWPGRLTLS----------PLTAFSDAAFSHCAQPLALR- 260

  Fly   336 RICLERVSHELLAGGNSQLEDEIIRTHTYDEDDLKLAFVVGGATGVCMVIFIITFALCLK----- 395
                                            ||.:.:.:|.|:      |:::.|.||.     
Human   261 --------------------------------DLAVVYTLGPAS------FLVSLASCLALGSGL 287

  Fly   396 SCCEMRKKKSNPEVATGVSAPLNPSQDSLP 425
            :.|..|:::.. ..|.....|.:|:.|..|
Human   288 TACRARRRRLR-TAALRPPRPPDPNPDPDP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 18/59 (31%)
LRR_RI <76..230 CDD:238064 43/153 (28%)
leucine-rich repeat 76..99 CDD:275380 4/22 (18%)
leucine-rich repeat 100..123 CDD:275380 8/22 (36%)
LRR_8 122..182 CDD:290566 14/59 (24%)
leucine-rich repeat 124..147 CDD:275380 8/22 (36%)
leucine-rich repeat 148..171 CDD:275380 2/22 (9%)
LRR_8 170..230 CDD:290566 21/59 (36%)
leucine-rich repeat 172..195 CDD:275380 8/22 (36%)
leucine-rich repeat 196..219 CDD:275380 9/22 (41%)
LRRC26NP_001013675.1 LRR 1 72..93 4/20 (20%)
LRR 2 96..117 7/20 (35%)
LRR_RI 97..>253 CDD:238064 54/228 (24%)
LRR_8 97..155 CDD:290566 22/81 (27%)
leucine-rich repeat 97..120 CDD:275380 8/22 (36%)
LRR 3 120..141 10/44 (23%)
leucine-rich repeat 121..144 CDD:275380 10/46 (22%)
LRR_8 143..202 CDD:290566 20/58 (34%)
LRR 4 144..167 7/22 (32%)
leucine-rich repeat 145..168 CDD:275380 8/22 (36%)
LRR 5 168..190 9/21 (43%)
leucine-rich repeat 169..192 CDD:275380 9/22 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..334 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.