DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and ltl

DIOPT Version :10

Sequence 1:NP_609761.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_729265.1 Gene:ltl / 38845 FlyBaseID:FBgn0268063 Length:817 Species:Drosophila melanogaster


Alignment Length:298 Identity:80/298 - (26%)
Similarity:119/298 - (39%) Gaps:62/298 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CRSKTQSQMFCPTVCHCDLHAQRNRAVCSAKRLISAN-----IEIPTTVEL--------LDLSYN 84
            |......||.|..:      ...|.::....:|.:||     ||..:..||        |.||.|
  Fly   294 CSKVETLQMGCNHI------KSLNSSLLPILKLKNANFSFNDIEEFSMAELHGLRSLKTLQLSSN 352

  Fly    85 DI-TTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHILESNNQL 148
            .| ..:.|......:.|:||.|.:|.|.:|.| |...|..||.|:|:.||||.:.....:...:|
  Fly   353 RIQRLLPDPRGVQELMLVNLDLDNNRIDSLNG-ALAGLGNLRILNLAGNRLEHLQVGDFDGMIRL 416

  Fly   149 IHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLLTLSP-- 211
            ..|:|.||:|:.|....:...|||:.|.:..:.:.:| .|....||.|.|.:|..|.:.|:|.  
  Fly   417 DILDLTGNQLAELKPLEMTLLPSLKILKVAYNNITKL-EQDFKGLPVLCQANLTNNQISTISSEL 480

  Fly   212 ------GDFHAPRNLASLNVEENPFNCD-------RALAKVATGLRQRGVAIFMSNCMEEEVQDH 263
                  .:.:.|..| .:::::||..||       |.:|.....:|.|      |.|.|      
  Fly   481 VTNTRCKNHNVPGKL-EIHLDDNPIMCDVGLNELCRLMAVQEARIRGR------SQCFE------ 532

  Fly   264 QDDAEA---------VNFP--NKNEKFESMEYLEPSTR 290
             :|.|.         ||.|  ..|.|....|..:|..|
  Fly   533 -NDQEVCTVLPMLYNVNLPIMVTNLKLTGREVPKPMVR 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_609761.1 LRR <66..>230 CDD:443914 54/185 (29%)
leucine-rich repeat 76..99 CDD:275380 8/31 (26%)
leucine-rich repeat 100..123 CDD:275380 10/22 (45%)
leucine-rich repeat 124..147 CDD:275380 8/22 (36%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
leucine-rich repeat 172..195 CDD:275380 5/22 (23%)
leucine-rich repeat 196..219 CDD:275380 7/30 (23%)
ltlNP_729265.1 LRR 65..476 CDD:443914 55/189 (29%)
leucine-rich repeat 65..86 CDD:275380
leucine-rich repeat 87..110 CDD:275380
leucine-rich repeat 111..134 CDD:275380
leucine-rich repeat 135..158 CDD:275380
leucine-rich repeat 159..180 CDD:275380
leucine-rich repeat 181..203 CDD:275380
leucine-rich repeat 204..226 CDD:275380
leucine-rich repeat 227..249 CDD:275380
leucine-rich repeat 250..272 CDD:275380
leucine-rich repeat 273..296 CDD:275380 1/1 (100%)
leucine-rich repeat 297..315 CDD:275380 4/23 (17%)
leucine-rich repeat 320..335 CDD:275378 5/14 (36%)
leucine-rich repeat 344..366 CDD:275380 6/21 (29%)
leucine-rich repeat 367..391 CDD:275380 10/24 (42%)
leucine-rich repeat 392..415 CDD:275380 8/22 (36%)
leucine-rich repeat 416..439 CDD:275380 7/22 (32%)
leucine-rich repeat 440..462 CDD:275380 5/22 (23%)
leucine-rich repeat 463..483 CDD:275380 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.