DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and Lapsyn

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_611561.1 Gene:Lapsyn / 37418 FlyBaseID:FBgn0034602 Length:343 Species:Drosophila melanogaster


Alignment Length:292 Identity:73/292 - (25%)
Similarity:120/292 - (41%) Gaps:68/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QILLYVGLLLCVLLQVCRSK---TQSQMFCPTVCHCDLHAQRNRAVCSAKRLISANIEIPTTVEL 78
            |:|.::     |.||:..|.   .||::...|..|.|   :..|..|....|......:.::||:
  Fly     6 QLLTFI-----VCLQLLHSAGFIIQSEVRKCTYGHID---KLLRIRCYDLDLKEVPQNLKSSVEV 62

  Fly    79 LDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHILE 143
            ||||:|.|..:...||:....:..|.|..|.|.::....|..||.|:.:|||.|.|..|...:.:
  Fly    63 LDLSHNRIRKLKTSSFQRYTDIKFLMLYDNMILSVEVGTFEPLTSLQEIDLSNNGLTTIPLELFQ 127

  Fly   144 SNNQLIHLNLEGNKLSTLG----KGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQN 204
            . .:|.:|.::.|:|::|.    :.|| |:| |..||:...::.:|..  |..||:|.||:.:.|
  Fly   128 L-PRLRNLYIDSNELTSLNLQALEKPI-RAP-LEYLNVAGCELQELPD--LGILPKLWQLNASMN 187

  Fly   205 --------------------------------------LLLTLSPGDFHAPRNLASLNVEENPFN 231
                                                  ::|..||.  ..|..|.:|::.|.|..
  Fly   188 PLQNFRIDSLANMCHLQVIDLTKSQLSQCGCQQVTNHLMMLGASPK--FVPVCLEALDIRECPLP 250

  Fly   232 CDRAL-----AKVATGLR---QRGVAIFMSNC 255
            .:|.:     |...|.|:   .|...:|.:.|
  Fly   251 YNRTIHSPTFASCQTTLQFAETRSFWLFGAGC 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 22/59 (37%)
LRR_RI <76..230 CDD:238064 51/195 (26%)
leucine-rich repeat 76..99 CDD:275380 10/22 (45%)
leucine-rich repeat 100..123 CDD:275380 6/22 (27%)
LRR_8 122..182 CDD:290566 20/63 (32%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
leucine-rich repeat 148..171 CDD:275380 8/26 (31%)
LRR_8 170..230 CDD:290566 19/97 (20%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 8/60 (13%)
LapsynNP_611561.1 leucine-rich repeat 39..59 CDD:275380 3/19 (16%)
LRR_8 58..118 CDD:290566 22/59 (37%)
leucine-rich repeat 60..83 CDD:275380 10/22 (45%)
leucine-rich repeat 84..107 CDD:275380 6/22 (27%)
LRR_RI <94..>249 CDD:238064 38/161 (24%)
LRR_8 106..167 CDD:290566 20/63 (32%)
LRR_4 106..145 CDD:289563 12/39 (31%)
leucine-rich repeat 108..130 CDD:275380 7/22 (32%)
leucine-rich repeat 131..154 CDD:275380 7/23 (30%)
leucine-rich repeat 157..178 CDD:275380 6/22 (27%)
leucine-rich repeat 179..202 CDD:275380 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.