DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and Toll-7

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster


Alignment Length:255 Identity:63/255 - (24%)
Similarity:110/255 - (43%) Gaps:34/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DLHAQRNRAV-----------------CSAKRLISANIEIPTTVEL-----LDLSYNDITTIDDD 92
            ::|.|:|...                 .|..:|.|.:::..|...|     |:|::|.:|.||..
  Fly   324 EIHLQQNELYELPKGLFHRLEQLLVVDLSGNQLTSNHVDNTTFAGLIRLIVLNLAHNALTRIDYR 388

  Fly    93 SFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHILESNNQLIHLNLEGNK 157
            :||....|..|.|.:|:|..:..:||:.|..|..|:|:.|||..:|:.:......|..|.|..|.
  Fly   389 TFKELYFLQILNLRNNSIGHIEDNAFLPLYNLHTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNL 453

  Fly   158 LSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLLTLSPGDFHAPRNLAS 222
            :|.:..........|:.|:|.::|:|:: .:.|..|..||.|||.:|.:.|.....|.....|..
  Fly   454 ISVVEPAVFKNCSDLKELDLSSNQLNEV-PRALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTG 517

  Fly   223 LNVEENPFNCDRALAKVATGLRQRGVAIFMSNCMEEEVQDHQDDAEAVNFPNKNEKFESM 282
            |.:      .|..:..:..|:.|....:.:.|..:..:|    ..|..:| :||.:.|::
  Fly   518 LRL------IDNQIGNITVGMFQDLPRLSVLNLAKNRIQ----SIERGSF-DKNFELEAI 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 22/64 (34%)
LRR_RI <76..230 CDD:238064 46/158 (29%)
leucine-rich repeat 76..99 CDD:275380 9/27 (33%)
leucine-rich repeat 100..123 CDD:275380 8/22 (36%)
LRR_8 122..182 CDD:290566 15/59 (25%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
LRR_8 170..230 CDD:290566 17/59 (29%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566
leucine-rich repeat 191..214 CDD:275380
leucine-rich repeat 215..248 CDD:275380
LRR_RI 247..501 CDD:238064 49/177 (28%)
LRR_8 247..308 CDD:290566
leucine-rich repeat 249..273 CDD:275380
leucine-rich repeat 274..297 CDD:275380
LRR_8 297..356 CDD:290566 4/31 (13%)
leucine-rich repeat 298..321 CDD:275380
leucine-rich repeat 322..345 CDD:275380 3/20 (15%)
LRR_8 345..406 CDD:290566 17/60 (28%)
leucine-rich repeat 346..371 CDD:275380 5/24 (21%)
leucine-rich repeat 372..395 CDD:275380 8/22 (36%)
leucine-rich repeat 396..419 CDD:275380 8/22 (36%)
LRR_8 419..478 CDD:290566 15/58 (26%)
leucine-rich repeat 420..443 CDD:275380 7/22 (32%)
leucine-rich repeat 444..467 CDD:275380 5/22 (23%)
LRR_RI 466..622 CDD:238064 27/113 (24%)
leucine-rich repeat 468..488 CDD:275380 6/20 (30%)
LRR_8 491..549 CDD:290566 14/63 (22%)
leucine-rich repeat 491..514 CDD:275380 8/22 (36%)
leucine-rich repeat 515..536 CDD:275380 5/26 (19%)
leucine-rich repeat 539..562 CDD:275380 6/27 (22%)
leucine-rich repeat 563..585 CDD:275380 1/4 (25%)
leucine-rich repeat 586..626 CDD:275380
leucine-rich repeat 627..653 CDD:275380
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468853
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.