DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and swi2

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_611247.3 Gene:swi2 / 37010 FlyBaseID:FBgn0034262 Length:499 Species:Drosophila melanogaster


Alignment Length:128 Identity:31/128 - (24%)
Similarity:46/128 - (35%) Gaps:40/128 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 NQLIHLNLEG---------------------NKLSTLGKGPILRSPS------------------ 171
            |.|..||..|                     |....|.|.|.|||.:                  
  Fly    90 NNLAALNQSGKLSRVQPALEMLLCGWPKDGLNHFRDLQKLPRLRSLTIEYSGFTEFKFDFPEMLE 154

  Fly   172 LRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLLTLSPGDFHAPRNLASLNVEENPFNCDR 234
            |.::|:..:.::.:.::....:..|:.|||..|.|:.|. |....|||...|.:..||:||.|
  Fly   155 LHTINISWTNLSYISSRTFKRVHPLKVLDLRWNQLIQLD-GPLLLPRNFEQLYLAGNPWNCTR 216

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566
LRR_RI <76..230 CDD:238064 27/122 (22%)
leucine-rich repeat 76..99 CDD:275380
leucine-rich repeat 100..123 CDD:275380
LRR_8 122..182 CDD:290566 14/74 (19%)