Sequence 1: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038939951.1 | Gene: | Lrg1 / 367455 | RGDID: | 1359464 | Length: | 342 | Species: | Rattus norvegicus |
Alignment Length: | 299 | Identity: | 71/299 - (23%) |
---|---|---|---|
Similarity: | 109/299 - (36%) | Gaps: | 79/299 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 GLLLCVLLQVCRSKTQSQMFCPTVCH---------------------------------C----D 50
Fly 51 LHAQRNRAVCSAKRLISANIEIPT-TVELLDLSYNDITTIDDDSFKTTIHLLNLT---------- 104
Fly 105 --------------LAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHILESNNQLIHLNLEG 155
Fly 156 NKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLLTLSPGDF----HA 216
Fly 217 PRNLA-SLNVEENPFNCDRALAKVATGLRQRGVAIFMSN 254 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 17/84 (20%) |
LRR_RI | <76..230 | CDD:238064 | 48/182 (26%) | ||
leucine-rich repeat | 76..99 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 100..123 | CDD:275380 | 7/46 (15%) | ||
LRR_8 | 122..182 | CDD:290566 | 22/59 (37%) | ||
leucine-rich repeat | 124..147 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 170..230 | CDD:290566 | 18/64 (28%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 8/26 (31%) | ||
Lrg1 | XP_038939951.1 | PRK15370 | <55..>293 | CDD:185268 | 54/242 (22%) |
leucine-rich repeat | 65..86 | CDD:275380 | 1/20 (5%) | ||
leucine-rich repeat | 87..110 | CDD:275380 | 6/27 (22%) | ||
leucine-rich repeat | 111..134 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 135..158 | CDD:275380 | 2/22 (9%) | ||
leucine-rich repeat | 159..182 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 183..206 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 207..230 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 231..254 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 255..278 | CDD:275380 | 8/22 (36%) | ||
PCC | 259..>339 | CDD:188093 | 16/60 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |