DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and rdo

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster


Alignment Length:360 Identity:83/360 - (23%)
Similarity:143/360 - (39%) Gaps:81/360 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLYVGLL--LCVLLQVCRSKTQSQMFCPTVCHCDL-HAQRNRAVCS---AKRLISAN---IEIPT 74
            :|:..||  ||: :....|.|:.:  |||.|.|.: ...|.:|:|:   ...|:|.|   :::..
  Fly     1 MLFKWLLFSLCI-MPAMFSNTKRK--CPTECQCSMDDLDRYQAICTKGGLNSLLSPNELDVDVKV 62

  Fly    75 TV--------------------------------------------ELLDLSYNDITTIDDDSFK 95
            .:                                            .:||||.|:||.|.:::|:
  Fly    63 IIIRGPRNSITIGPALRQFMKLEILRITDSNLPAIGAESFWGLKYLRILDLSKNNITNITENNFR 127

  Fly    96 TTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHILESNNQLIHLNLEGNKLST 160
            ...:||.|.|:.|.:..:....|..||.||.|:|:.|.:.::.:......::|.:|:|.||.|..
  Fly   128 GQDNLLELDLSKNKVLRMASSTFRHLTDLRRLNLADNSIVELVQRNFFMLSRLKYLDLSGNPLQD 192

  Fly   161 LGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLLTLSPGDFHAPRNLASLNV 225
            |........|.|:.|..||.|:.::..|:.:.||.|.:|||.:|....|...:|...:.|..:.:
  Fly   193 LQPDVFRDVPELKVLKCRNCQLKKINPQMYNLLPLLSELDLGRNEFKFLDKDEFRDVKRLTKVLL 257

  Fly   226 EENPFNCDRALAKVATGLRQRGVAIFMSNCMEEEVQDHQDDA--EAVNFPN------KNEKFESM 282
            :.|                |..|.:.....|::.: :|.|.:  .....||      .|..|..:
  Fly   258 DGN----------------QLSVVVDQLFRMQKSL-NHLDLSYNRLAKVPNDSFLQLTNLTFLDL 305

  Fly   283 EYLEPSTRGPQSVLSVWRDLDSSEEQNSSQDDEQM 317
            .|.:.....|||:.|:...|..:...|...|..:|
  Fly   306 SYNKLVRLEPQSIRSLSNLLTLNISGNVLMDLREM 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 22/103 (21%)
LRR_RI <76..230 CDD:238064 47/197 (24%)
leucine-rich repeat 76..99 CDD:275380 9/66 (14%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
LRR_8 122..182 CDD:290566 18/59 (31%)
leucine-rich repeat 124..147 CDD:275380 5/22 (23%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
LRR_8 170..230 CDD:290566 18/59 (31%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380 0/22 (0%)
leucine-rich repeat 108..131 CDD:275380 9/22 (41%)
LRR_8 131..190 CDD:290566 18/58 (31%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
LRR_RI 151..422 CDD:238064 50/207 (24%)
leucine-rich repeat 156..179 CDD:275380 5/22 (23%)
LRR_8 178..262 CDD:290566 25/99 (25%)
leucine-rich repeat 180..203 CDD:275380 7/22 (32%)
leucine-rich repeat 204..251 CDD:275380 15/46 (33%)
leucine-rich repeat 252..275 CDD:275380 5/38 (13%)
LRR_8 274..334 CDD:290566 13/60 (22%)
leucine-rich repeat 276..299 CDD:275380 4/23 (17%)
LRR_4 298..342 CDD:289563 11/43 (26%)
leucine-rich repeat 300..323 CDD:275380 6/22 (27%)
leucine-rich repeat 388..411 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453771
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.