DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and IGFALS

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001139478.1 Gene:IGFALS / 3483 HGNCID:5468 Length:643 Species:Homo sapiens


Alignment Length:226 Identity:61/226 - (26%)
Similarity:94/226 - (41%) Gaps:32/226 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CPTVCHC--DLHAQRNRAVCSAKRLISANIEIPTTVELLDLSYNDITTIDDDSFK--TTIHLLNL 103
            ||..|.|  |..|......||::.|......:|...:.|.|..|:::::...:|:  :::..|||
Human    79 CPAACVCSYDDDADELSVFCSSRNLTRLPDGVPGGTQALWLDGNNLSSVPPAAFQNLSSLGFLNL 143

  Fly   104 -----------------TLAH-----NAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHILESNN 146
                             .|.|     |.:.:|....|.....|..|.||.|||.::::.:.|...
Human   144 QGGQLGSLEPQALLGLENLCHLHLERNQLRSLALGTFAHTPALASLGLSNNRLSRLEDGLFEGLG 208

  Fly   147 QLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLLTLSP 211
            .|..|||..|.|:.|.........|||.|.|..:::..|...|.|.|.:||:|||::|.|..:..
Human   209 SLWDLNLGWNSLAVLPDAAFRGLGSLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKA 273

  Fly   212 GDFHAPRNLASLNVEENPFNCDRALAKVATG 242
            ..|.....|..|.::.|      .:|.||.|
Human   274 NVFVQLPRLQKLYLDRN------LIAAVAPG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 17/83 (20%)
LRR_RI <76..230 CDD:238064 47/177 (27%)
leucine-rich repeat 76..99 CDD:275380 4/24 (17%)
leucine-rich repeat 100..123 CDD:275380 8/44 (18%)
LRR_8 122..182 CDD:290566 20/59 (34%)
leucine-rich repeat 124..147 CDD:275380 8/22 (36%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
LRR_8 170..230 CDD:290566 20/59 (34%)
leucine-rich repeat 172..195 CDD:275380 8/22 (36%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
IGFALSNP_001139478.1 LRRNT 78..116 CDD:214470 10/36 (28%)
leucine-rich repeat 95..113 CDD:275380 4/17 (24%)
leucine-rich repeat 114..137 CDD:275380 4/22 (18%)
leucine-rich repeat 138..161 CDD:275380 3/22 (14%)
LRR_8 141..196 CDD:290566 13/54 (24%)
leucine-rich repeat 162..185 CDD:275380 5/22 (23%)
LRR_8 184..244 CDD:290566 20/59 (34%)
leucine-rich repeat 186..209 CDD:275380 8/22 (36%)
leucine-rich repeat 210..233 CDD:275380 7/22 (32%)
leucine-rich repeat 234..257 CDD:275380 8/22 (36%)
LRR_8 257..316 CDD:290566 15/48 (31%)
leucine-rich repeat 258..281 CDD:275380 8/22 (36%)
leucine-rich repeat 282..305 CDD:275380 7/23 (30%)
leucine-rich repeat 306..324 CDD:275380
LRR_8 336..388 CDD:290566
leucine-rich repeat 354..377 CDD:275380
LRR_8 377..433 CDD:290566
leucine-rich repeat 378..401 CDD:275380
leucine-rich repeat 402..423 CDD:275380
LRR_8 425..484 CDD:290566
leucine-rich repeat 426..447 CDD:275380
leucine-rich repeat 450..473 CDD:275380
leucine-rich repeat 474..497 CDD:275380
LRR_8 476..532 CDD:290566
leucine-rich repeat 498..519 CDD:275380
leucine-rich repeat 522..543 CDD:275380
LRR_8 524..575 CDD:290566
leucine-rich repeat 546..565 CDD:275380
TPKR_C2 574..618 CDD:301599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.