DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and kek5

DIOPT Version :10

Sequence 1:NP_609761.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_573382.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster


Alignment Length:331 Identity:72/331 - (21%)
Similarity:131/331 - (39%) Gaps:47/331 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LGLKQILLYVGLLLCVLLQVCRSKTQSQMFCPTVCHCDLHAQRNRAVCSAKRLISANIEIPTTVE 77
            ||:..:||.|.::|..|.......|.....|.| |||..::.:..|.|..|.|.....::...::
  Fly    13 LGMILLLLGVLVVLMALPPPTAGTTDWMQSCGT-CHCQWNSGKKSADCKNKALTKIPQDMSNEMQ 76

  Fly    78 LLDLSYNDITTIDDDSF----KTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQID 138
            :||.::|.|..:..:.|    ...:|  .:.|.:..|..::.:||..|..|..||||.||:.::.
  Fly    77 VLDFAHNQIPELRREEFLLAGLPNVH--KIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELH 139

  Fly   139 EHILESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQ 203
            ........:|.::.:..|::..|.....:....|..:..||:::.|:...:.:....|..:.|.|
  Fly   140 PGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQ 204

  Fly   204 NLLLTLSPGDFHAPRNLASLNVEENPFNCDRALAKVATGLRQRGVAIFMSNCMEEEVQDHQDDAE 268
            |.|..|....|...:.|..|:::.|.:||                     :|   |:||.:|.| 
  Fly   205 NRLSHLHKETFKDLQKLMHLSLQGNAWNC---------------------SC---ELQDFRDFA- 244

  Fly   269 AVNFPNKNEKFESMEYLEPS--TRGPQSVLSVWRDLDSSEEQNSSQDDEQMSSLSDVCEGSREKL 331
                      .....|..|:  ...||....:|.::.|   :|.:.....:.|:....|.:.:.:
  Fly   245 ----------ISKRLYTPPTDCQEPPQLRGKLWSEVPS---ENFACRPRILGSVRSFIEANHDNI 296

  Fly   332 CLRYRI 337
            .|..||
  Fly   297 SLPCRI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_609761.1 LRR <66..>230 CDD:443914 35/167 (21%)
leucine-rich repeat 76..99 CDD:275380 5/26 (19%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
leucine-rich repeat 148..171 CDD:275380 3/22 (14%)
leucine-rich repeat 172..195 CDD:275380 4/22 (18%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
kek5NP_573382.1 LRR <76..>229 CDD:443914 34/154 (22%)
leucine-rich repeat 76..100 CDD:275380 5/23 (22%)
leucine-rich repeat 101..124 CDD:275380 6/24 (25%)
leucine-rich repeat 125..148 CDD:275380 7/22 (32%)
leucine-rich repeat 149..172 CDD:275380 3/22 (14%)
leucine-rich repeat 173..196 CDD:275380 4/22 (18%)
leucine-rich repeat 197..220 CDD:275380 7/22 (32%)
LRRCT 229..277 CDD:214507 16/85 (19%)
Ig 296..379 CDD:472250 3/7 (43%)
Ig strand B 296..300 CDD:409353 1/3 (33%)
Ig strand C 309..313 CDD:409353
Ig strand E 345..349 CDD:409353
Ig strand F 359..364 CDD:409353
Ig strand G 372..375 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.