DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and Islr2

DIOPT Version :10

Sequence 1:NP_609761.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001155007.1 Gene:Islr2 / 320563 MGIID:2444277 Length:789 Species:Mus musculus


Alignment Length:215 Identity:66/215 - (30%)
Similarity:96/215 - (44%) Gaps:36/215 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LCV---LLQVCRSKTQSQMFCPTVCHC-DLHAQRNRAVCSAKRLISANIEIPTTVELLDLSYNDI 86
            ||:   ||.|.|:       ||..|.| |.:|.: .|.|:.|.|......:|..|..|.||.|.|
Mouse    51 LCLAWALLGVVRA-------CPEPCACVDKYAHQ-FADCAYKELREVPEGLPANVTTLSLSANKI 107

  Fly    87 TTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHILESNNQLIHL 151
            |.:...:|.....:.:|.|||:.:.|:...|...|::|:.||||:|.:.                
Mouse   108 TVLRRGAFVNVTQVTSLWLAHSEVRTVESGALAVLSQLKNLDLSHNLIS---------------- 156

  Fly   152 NLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLLTLSPGDFHA 216
            |...:.|..|.        :|:.|.:.::::..|....|.|||.||.|.:..|.|.||.||.|.|
Mouse   157 NFPWSDLRNLS--------ALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLEPGTFDA 213

  Fly   217 PRNLASLNVEENPFNCDRAL 236
            ...|:.|.:..|||:|...|
Mouse   214 LSALSHLQLYHNPFHCSCGL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_609761.1 LRR <66..>230 CDD:443914 46/163 (28%)
leucine-rich repeat 76..99 CDD:275380 8/22 (36%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
leucine-rich repeat 124..147 CDD:275380 6/22 (27%)
leucine-rich repeat 148..171 CDD:275380 3/22 (14%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 11/22 (50%)
Islr2NP_001155007.1 leucine-rich repeat 80..96 CDD:275380 4/15 (27%)
LRR <95..>227 CDD:443914 45/155 (29%)
leucine-rich repeat 97..120 CDD:275380 8/22 (36%)
leucine-rich repeat 121..144 CDD:275380 7/22 (32%)
leucine-rich repeat 145..168 CDD:275380 9/46 (20%)
leucine-rich repeat 169..192 CDD:275380 6/22 (27%)
leucine-rich repeat 193..216 CDD:275380 11/22 (50%)
PCC 198..>272 CDD:188093 15/36 (42%)
Ig_3 276..404 CDD:464046
Ig <395..417 CDD:472250
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.