DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and Lrrc26

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001014075.1 Gene:Lrrc26 / 311803 RGDID:1308398 Length:334 Species:Rattus norvegicus


Alignment Length:454 Identity:97/454 - (21%)
Similarity:156/454 - (34%) Gaps:168/454 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLLCVLLQVCRSKTQSQM-----------FCPTVCHCDLHAQRNRAVCSAKRLISANIEIPTTVE 77
            |||.:||...|..||..:           .||..|.|   :...:|.|||..|.:....:...|.
  Rat    17 LLLLLLLSWRRVWTQEHIGTDPSKSPVAPVCPEACSC---SPGGKANCSALALPAVPAGLSWQVR 78

  Fly    78 LLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHIL 142
            .|.|..|.::|:...:|.....||.|.|..|.:.:::..||..|..|:.||||.|:||.:.....
  Rat    79 SLLLDRNRVSTLPPGAFADAGALLYLVLRENRLRSVHARAFWGLGVLQRLDLSSNQLETLSPGTF 143

  Fly   143 ESNNQLIHLNLEGNKLSTLGK---GPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQN 204
            .....|..|:|.||:|:.|..   ||:   |.||.|:|:::.::.|...||::||   .||:   
  Rat   144 TPLRALSFLSLAGNRLALLEPSILGPL---PLLRVLSLQDNSLSALEAGLLNSLP---ALDV--- 199

  Fly   205 LLLTLSPGDFHAPRNLASLNVEENPFNCDRALAKVATGLRQRGVAIFMSNCMEEEVQDHQDDAEA 269
                              |.:..||:.|..||..:.|.||:.                       
  Rat   200 ------------------LRLHGNPWACSCALRPLCTWLRKH----------------------- 223

  Fly   270 VNFPNKNEKFESMEYLEPSTRGPQSVLSVWRDLDSSEEQNSSQDDEQMSSLSDVCEGSREKLCLR 334
               |....:.|::..:.|..                         :.::.|:|..:.:       
  Rat   224 ---PRPTSETETLLCVSPKL-------------------------QTLNLLTDFPDNA------- 253

  Fly   335 YRICLERVSHELLAGGNSQLEDEIIRTHTYDEDDLKLAFVVGGATGVCMVIFIITFALCLKSCCE 399
            ::.|                      |.:....||.:.:.:|.|:      |:.:.|:||     
  Rat   254 FKQC----------------------TQSLAARDLAVVYALGPAS------FLASLAICL----- 285

  Fly   400 MRKKKSNPEVATGVSAPLNPSQDSLPTIHTWSPQRTRNPRRSNPQRPRSTQSHAVVRQ--PYGP 461
                                   :|.::.|....|.|        |.|:|..|.:.||  |.||
  Rat   286 -----------------------ALGSVLTACGARRR--------RRRTTVRHLIRRQPDPEGP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 20/59 (34%)
LRR_RI <76..230 CDD:238064 45/156 (29%)
leucine-rich repeat 76..99 CDD:275380 6/22 (27%)
leucine-rich repeat 100..123 CDD:275380 8/22 (36%)
LRR_8 122..182 CDD:290566 22/62 (35%)
leucine-rich repeat 124..147 CDD:275380 8/22 (36%)
leucine-rich repeat 148..171 CDD:275380 9/25 (36%)
LRR_8 170..230 CDD:290566 14/59 (24%)
leucine-rich repeat 172..195 CDD:275380 8/22 (36%)
leucine-rich repeat 196..219 CDD:275380 2/22 (9%)
Lrrc26NP_001014075.1 LRR_8 76..135 CDD:290566 20/58 (34%)
LRR 1 76..97 6/20 (30%)
leucine-rich repeat 77..100 CDD:275380 6/22 (27%)
LRR 2 100..121 7/20 (35%)
leucine-rich repeat 101..124 CDD:275380 8/22 (36%)
LRR 3 124..145 8/20 (40%)
LRR_8 125..183 CDD:290566 22/60 (37%)
LRR_4 125..164 CDD:289563 15/38 (39%)
leucine-rich repeat 125..148 CDD:275380 8/22 (36%)
LRR 4 148..169 7/20 (35%)
leucine-rich repeat 149..172 CDD:275380 9/25 (36%)
LRR 5 172..194 7/21 (33%)
leucine-rich repeat 173..196 CDD:275380 9/25 (36%)
leucine-rich repeat 197..239 CDD:275380 13/88 (15%)
TPKR_C2 205..258 CDD:301599 14/132 (11%)
leucine-rich repeat 240..259 CDD:275380 3/72 (4%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..334 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.