DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and hfw

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001259135.1 Gene:hfw / 31120 FlyBaseID:FBgn0001189 Length:611 Species:Drosophila melanogaster


Alignment Length:209 Identity:59/209 - (28%)
Similarity:87/209 - (41%) Gaps:57/209 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CPTV-----CHCDLH----AQRNRAV------CSAKRLISANIEIPTTVELLDLSYNDITTIDDD 92
            ||.:     |:|.|.    .|.|::.      ||...|:.....:|....:|:::.|.||:: .|
  Fly   370 CPVIPNYGSCNCTLENIMIIQDNQSKPQCHVDCSNLGLVELPQRLPDNTFMLNITNNKITSL-GD 433

  Fly    93 SFKT--TIHLLNLTLA-HNAIHTLY---GDAFVELTRLRYLDLSYNRLEQIDEHILESNNQLI-- 149
            .|.|  |.|.:|..|| :|.|.::|   |..|:|..:..|  :..|.|.:|.|:.|  ||.|:  
  Fly   434 YFHTNPTYHNINRLLADNNQISSIYEFEGTKFIETFQRIY--MRNNSLSKIPEYFL--NNALMDS 494

  Fly   150 ----HLNLEGNKL-------STLGKGPILRS---PSLRSLNLRNSQVNQLGTQLLSALPQLRQLD 200
                .:.|.||||       .||......||   |....:..||             :|| |.::
  Fly   495 GLGRRIYLAGNKLQCDCNSAKTLQNWLKERSSDIPDYMEIRCRN-------------MPQ-RVIE 545

  Fly   201 LAQNLLLTLSPGDF 214
            | |...|..||.|:
  Fly   546 L-QEAKLCQSPPDW 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 20/65 (31%)
LRR_RI <76..230 CDD:238064 48/161 (30%)
leucine-rich repeat 76..99 CDD:275380 8/24 (33%)
leucine-rich repeat 100..123 CDD:275380 9/26 (35%)
LRR_8 122..182 CDD:290566 21/75 (28%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
leucine-rich repeat 148..171 CDD:275380 10/38 (26%)
LRR_8 170..230 CDD:290566 12/45 (27%)
leucine-rich repeat 172..195 CDD:275380 2/22 (9%)
leucine-rich repeat 196..219 CDD:275380 7/19 (37%)
hfwNP_001259135.1 LRR_8 235..294 CDD:290566
leucine-rich repeat 237..259 CDD:275378
leucine-rich repeat 260..283 CDD:275378
leucine-rich repeat 284..304 CDD:275378
leucine-rich repeat 420..443 CDD:275378 8/23 (35%)
leucine-rich repeat 444..465 CDD:275378 7/20 (35%)
leucine-rich repeat 466..497 CDD:275378 10/34 (29%)
leucine-rich repeat 498..509 CDD:275378 5/10 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.