DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and Lrrc55

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001381943.1 Gene:Lrrc55 / 311171 RGDID:1561726 Length:311 Species:Rattus norvegicus


Alignment Length:251 Identity:68/251 - (27%)
Similarity:99/251 - (39%) Gaps:40/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CVTKPKM--------WLGLKQILLYVGLLLCVLLQVCRSKTQSQMFCPTVCHCDLHAQRNRAV-C 60
            |...|||        |.|.....|   ||:..||......:.:...||.:|.|     ||:.| |
  Rat     8 CCQLPKMGDTWAQLPWPGPPHSAL---LLVFFLLAAGVMHSDAGASCPVLCTC-----RNQVVDC 64

  Fly    61 SAKRLISANIEIPTTVELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLR 125
            |.:||.|...::|.....|.|::|.|..:........:.|..|.|.:|::..|....|:...||.
  Rat    65 SNQRLFSVPPDLPMDTRNLSLAHNRIAAVPPGYLTCYMELRVLDLRNNSLMELPPGLFLHAKRLA 129

  Fly   126 YLDLSYNRLEQIDEHILESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLL 190
            :||||||.|..:...:....:.|:|::|..|             |.||.::          .|..
  Rat   130 HLDLSYNNLSHVPADMFREAHGLVHIDLSHN-------------PWLRRVH----------PQAF 171

  Fly   191 SALPQLRQLDLAQNLLLTLSPGDFHAPRNLASLNVEENPFNCDRALAKVATGLRQR 246
            ..|..||.|||:...|..||.........|.:|.:..||:.|...:..:...||.|
  Rat   172 QGLVHLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNR 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 18/59 (31%)
LRR_RI <76..230 CDD:238064 39/153 (25%)
leucine-rich repeat 76..99 CDD:275380 4/22 (18%)
leucine-rich repeat 100..123 CDD:275380 6/22 (27%)
LRR_8 122..182 CDD:290566 16/59 (27%)
leucine-rich repeat 124..147 CDD:275380 8/22 (36%)
leucine-rich repeat 148..171 CDD:275380 4/22 (18%)
LRR_8 170..230 CDD:290566 16/59 (27%)
leucine-rich repeat 172..195 CDD:275380 4/22 (18%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
Lrrc55NP_001381943.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.