DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and Lrrc55

DIOPT Version :10

Sequence 1:NP_609761.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001381943.1 Gene:Lrrc55 / 311171 RGDID:1561726 Length:311 Species:Rattus norvegicus


Alignment Length:251 Identity:68/251 - (27%)
Similarity:99/251 - (39%) Gaps:40/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CVTKPKM--------WLGLKQILLYVGLLLCVLLQVCRSKTQSQMFCPTVCHCDLHAQRNRAV-C 60
            |...|||        |.|.....|   ||:..||......:.:...||.:|.|     ||:.| |
  Rat     8 CCQLPKMGDTWAQLPWPGPPHSAL---LLVFFLLAAGVMHSDAGASCPVLCTC-----RNQVVDC 64

  Fly    61 SAKRLISANIEIPTTVELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLR 125
            |.:||.|...::|.....|.|::|.|..:........:.|..|.|.:|::..|....|:...||.
  Rat    65 SNQRLFSVPPDLPMDTRNLSLAHNRIAAVPPGYLTCYMELRVLDLRNNSLMELPPGLFLHAKRLA 129

  Fly   126 YLDLSYNRLEQIDEHILESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLL 190
            :||||||.|..:...:....:.|:|::|..|             |.||.::          .|..
  Rat   130 HLDLSYNNLSHVPADMFREAHGLVHIDLSHN-------------PWLRRVH----------PQAF 171

  Fly   191 SALPQLRQLDLAQNLLLTLSPGDFHAPRNLASLNVEENPFNCDRALAKVATGLRQR 246
            ..|..||.|||:...|..||.........|.:|.:..||:.|...:..:...||.|
  Rat   172 QGLVHLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNR 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_609761.1 LRR <66..>230 CDD:443914 41/163 (25%)
leucine-rich repeat 76..99 CDD:275380 4/22 (18%)
leucine-rich repeat 100..123 CDD:275380 6/22 (27%)
leucine-rich repeat 124..147 CDD:275380 8/22 (36%)
leucine-rich repeat 148..171 CDD:275380 4/22 (18%)
leucine-rich repeat 172..195 CDD:275380 4/22 (18%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
Lrrc55NP_001381943.1 LRR <60..>237 CDD:443914 51/191 (27%)
leucine-rich repeat 60..79 CDD:275380 7/18 (39%)
leucine-rich repeat 80..103 CDD:275380 4/22 (18%)
leucine-rich repeat 104..127 CDD:275380 6/22 (27%)
leucine-rich repeat 128..151 CDD:275380 8/22 (36%)
leucine-rich repeat 152..176 CDD:275380 9/46 (20%)
leucine-rich repeat 177..200 CDD:275380 8/22 (36%)

Return to query results.
Submit another query.