| Sequence 1: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_852045.1 | Gene: | Rtn4rl2 / 311169 | RGDID: | 727797 | Length: | 420 | Species: | Rattus norvegicus |
| Alignment Length: | 239 | Identity: | 72/239 - (30%) |
|---|---|---|---|
| Similarity: | 103/239 - (43%) | Gaps: | 28/239 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 14 GLKQILLYVGLLLCVLLQVCR--SKTQSQMFCPTVCHCDLHAQRNRAVCSAKRLISANIEIPTTV 76
Fly 77 ELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNR-LEQIDEH 140
Fly 141 ILESNNQLIHLNLEGNKLSTLGKGPILRS-PSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQN 204
Fly 205 LLLTLSPGDFHAPRNLASLNVEENPFNCDRALAKVATGLRQRGV 248 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 20/60 (33%) |
| LRR_RI | <76..230 | CDD:238064 | 48/155 (31%) | ||
| leucine-rich repeat | 76..99 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 122..182 | CDD:290566 | 20/61 (33%) | ||
| leucine-rich repeat | 124..147 | CDD:275380 | 7/23 (30%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 9/23 (39%) | ||
| LRR_8 | 170..230 | CDD:290566 | 18/59 (31%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 7/22 (32%) | ||
| Rtn4rl2 | NP_852045.1 | LRR_8 | 60..117 | CDD:290566 | 18/58 (31%) |
| LRR 1 | 61..82 | 5/20 (25%) | |||
| leucine-rich repeat | 62..83 | CDD:275380 | 5/22 (23%) | ||
| LRR 2 | 83..104 | 8/20 (40%) | |||
| leucine-rich repeat | 84..107 | CDD:275380 | 9/22 (41%) | ||
| LRR_RI | 103..>261 | CDD:238064 | 42/132 (32%) | ||
| LRR 3 | 107..129 | 7/21 (33%) | |||
| LRR_8 | 108..167 | CDD:290566 | 20/59 (34%) | ||
| leucine-rich repeat | 108..132 | CDD:275380 | 7/23 (30%) | ||
| LRR 4 | 132..153 | 8/21 (38%) | |||
| leucine-rich repeat | 133..156 | CDD:275380 | 9/23 (39%) | ||
| LRR_8 | 156..215 | CDD:290566 | 22/73 (30%) | ||
| LRR 5 | 156..177 | 6/20 (30%) | |||
| leucine-rich repeat | 157..180 | CDD:275380 | 6/22 (27%) | ||
| LRR 6 | 180..201 | 7/23 (30%) | |||
| leucine-rich repeat | 181..204 | CDD:275380 | 9/25 (36%) | ||
| LRR_8 | 204..262 | CDD:290566 | 9/27 (33%) | ||
| LRR 7 | 204..225 | 9/27 (33%) | |||
| leucine-rich repeat | 205..228 | CDD:275380 | 8/26 (31%) | ||
| LRR 8 | 228..249 | ||||
| leucine-rich repeat | 229..252 | CDD:275380 | |||
| TPKR_C2 | 261..311 | CDD:301599 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 286..390 | ||||
| Important for interaction with MAG. /evidence=ECO:0000269|PubMed:19420245 | 315..327 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||