Sequence 1: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013400.1 | Gene: | Lrrc52 / 240899 | MGIID: | 1924118 | Length: | 314 | Species: | Mus musculus |
Alignment Length: | 326 | Identity: | 84/326 - (25%) |
---|---|---|---|
Similarity: | 114/326 - (34%) | Gaps: | 67/326 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 KQILLYVGLLLCVLLQVCRSKTQSQMFCPTVCHCDLHAQRNRAVCSAKRLISANIEIPTTVELLD 80
Fly 81 LSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHILESN 145
Fly 146 NQLIHLNLEGN-KLSTLGKGPILRSPSLRSLNLRNSQVN-----------QLGTQLLSALPQLRQ 198
Fly 199 ---LDLAQNLLLTLSPGDFHAPRNLASLNVEE----------NPFN------------------- 231
Fly 232 -CDRALAKVATGLRQRGV-AIFMSNCMEEEVQDHQDDAEAVNFPNKNEKFESMEYLEPSTRGPQS 294
Fly 295 V 295 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 18/59 (31%) |
LRR_RI | <76..230 | CDD:238064 | 48/178 (27%) | ||
leucine-rich repeat | 76..99 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 100..123 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 122..182 | CDD:290566 | 24/60 (40%) | ||
leucine-rich repeat | 124..147 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 7/23 (30%) | ||
LRR_8 | 170..230 | CDD:290566 | 21/83 (25%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 10/33 (30%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 6/25 (24%) | ||
Lrrc52 | NP_001013400.1 | leucine-rich repeat | 35..54 | CDD:275380 | 4/18 (22%) |
LRR 1 | 54..73 | 5/18 (28%) | |||
leucine-rich repeat | 56..78 | CDD:275380 | 5/21 (24%) | ||
LRR 2 | 78..99 | 5/20 (25%) | |||
LRR_8 | 79..136 | CDD:316378 | 18/56 (32%) | ||
leucine-rich repeat | 79..102 | CDD:275380 | 5/22 (23%) | ||
LRR 3 | 102..123 | 10/20 (50%) | |||
leucine-rich repeat | 103..126 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 125..185 | CDD:316378 | 18/59 (31%) | ||
LRR 4 | 126..148 | 7/21 (33%) | |||
leucine-rich repeat | 127..151 | CDD:275380 | 7/23 (30%) | ||
LRR 5 | 151..172 | 7/20 (35%) | |||
leucine-rich repeat | 152..175 | CDD:275380 | 6/22 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |