Sequence 1: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_666229.1 | Gene: | Lrrc26 / 227618 | MGIID: | 2385129 | Length: | 331 | Species: | Mus musculus |
Alignment Length: | 236 | Identity: | 67/236 - (28%) |
---|---|---|---|
Similarity: | 105/236 - (44%) | Gaps: | 44/236 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 LLLCVLLQVCRSKTQSQM-----------FCPTVCHCDLHAQRNRAVCSAKRLISANIEIPTTVE 77
Fly 78 LLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHIL 142
Fly 143 ESNNQLIHLNLEGNKLSTLGK---GPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQN 204
Fly 205 LLLTLSPGDFHAPRNLASLNVEENPFNCDRALAKVATGLRQ 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 19/59 (32%) |
LRR_RI | <76..230 | CDD:238064 | 43/156 (28%) | ||
leucine-rich repeat | 76..99 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 100..123 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 122..182 | CDD:290566 | 22/62 (35%) | ||
leucine-rich repeat | 124..147 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 9/25 (36%) | ||
LRR_8 | 170..230 | CDD:290566 | 13/59 (22%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 2/22 (9%) | ||
Lrrc26 | NP_666229.1 | LRR_8 | 72..131 | CDD:290566 | 19/58 (33%) |
LRR 1 | 72..93 | 5/20 (25%) | |||
leucine-rich repeat | 73..96 | CDD:275380 | 5/22 (23%) | ||
LRR 2 | 96..117 | 7/20 (35%) | |||
leucine-rich repeat | 97..120 | CDD:275380 | 8/22 (36%) | ||
LRR | 118..141 | CDD:197688 | 9/22 (41%) | ||
LRR 3 | 120..141 | 8/20 (40%) | |||
LRR_8 | 121..179 | CDD:290566 | 22/60 (37%) | ||
leucine-rich repeat | 121..144 | CDD:275380 | 8/22 (36%) | ||
LRR 4 | 144..165 | 7/20 (35%) | |||
leucine-rich repeat | 145..168 | CDD:275380 | 9/25 (36%) | ||
LRR 5 | 168..191 | 6/22 (27%) | |||
LRR_4 | 169..204 | CDD:289563 | 13/58 (22%) | ||
leucine-rich repeat | 169..192 | CDD:275380 | 8/25 (32%) | ||
TPKR_C2 | 201..244 | CDD:301599 | 8/18 (44%) | ||
leucine-rich repeat | 236..255 | CDD:275380 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 310..331 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |