| Sequence 1: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_666229.1 | Gene: | Lrrc26 / 227618 | MGIID: | 2385129 | Length: | 331 | Species: | Mus musculus |
| Alignment Length: | 236 | Identity: | 67/236 - (28%) |
|---|---|---|---|
| Similarity: | 105/236 - (44%) | Gaps: | 44/236 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 24 LLLCVLLQVCRSKTQSQM-----------FCPTVCHCDLHAQRNRAVCSAKRLISANIEIPTTVE 77
Fly 78 LLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHIL 142
Fly 143 ESNNQLIHLNLEGNKLSTLGK---GPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQN 204
Fly 205 LLLTLSPGDFHAPRNLASLNVEENPFNCDRALAKVATGLRQ 245 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 19/59 (32%) |
| LRR_RI | <76..230 | CDD:238064 | 43/156 (28%) | ||
| leucine-rich repeat | 76..99 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 122..182 | CDD:290566 | 22/62 (35%) | ||
| leucine-rich repeat | 124..147 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 9/25 (36%) | ||
| LRR_8 | 170..230 | CDD:290566 | 13/59 (22%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 2/22 (9%) | ||
| Lrrc26 | NP_666229.1 | LRR_8 | 72..131 | CDD:290566 | 19/58 (33%) |
| LRR 1 | 72..93 | 5/20 (25%) | |||
| leucine-rich repeat | 73..96 | CDD:275380 | 5/22 (23%) | ||
| LRR 2 | 96..117 | 7/20 (35%) | |||
| leucine-rich repeat | 97..120 | CDD:275380 | 8/22 (36%) | ||
| LRR | 118..141 | CDD:197688 | 9/22 (41%) | ||
| LRR 3 | 120..141 | 8/20 (40%) | |||
| LRR_8 | 121..179 | CDD:290566 | 22/60 (37%) | ||
| leucine-rich repeat | 121..144 | CDD:275380 | 8/22 (36%) | ||
| LRR 4 | 144..165 | 7/20 (35%) | |||
| leucine-rich repeat | 145..168 | CDD:275380 | 9/25 (36%) | ||
| LRR 5 | 168..191 | 6/22 (27%) | |||
| LRR_4 | 169..204 | CDD:289563 | 13/58 (22%) | ||
| leucine-rich repeat | 169..192 | CDD:275380 | 8/25 (32%) | ||
| TPKR_C2 | 201..244 | CDD:301599 | 8/18 (44%) | ||
| leucine-rich repeat | 236..255 | CDD:275380 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 310..331 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||