DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and LRRC55

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001005210.2 Gene:LRRC55 / 219527 HGNCID:32324 Length:298 Species:Homo sapiens


Alignment Length:224 Identity:62/224 - (27%)
Similarity:96/224 - (42%) Gaps:29/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLLCVLLQVCRSKTQSQMFCPTVCHCDLHAQRNRAV-CSAKRLISANIEIPTTVELLDLSYNDIT 87
            ||:.:||......:.:...||.:|.|     ||:.| ||::||.|...::|.....|.|::|.||
Human    19 LLISLLLAAGLMHSDAGTSCPVLCTC-----RNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRIT 78

  Fly    88 TIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHILESNNQLIHLN 152
            .:........:.|..|.|.:|::..|....|:...||.:||||||....:...:.:..:.|:|::
Human    79 AVPPGYLTCYMELQVLDLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAHGLVHID 143

  Fly   153 LEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLLTLSPGDFHAP 217
            |..|             |.||.::          .|....|.|||.|||:...|..||.......
Human   144 LSHN-------------PWLRRVH----------PQAFQGLMQLRDLDLSYGGLAFLSLEALEGL 185

  Fly   218 RNLASLNVEENPFNCDRALAKVATGLRQR 246
            ..|.:|.:..||:.|...:..:...||.|
Human   186 PGLVTLQIGGNPWVCGCTMEPLLKWLRNR 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 19/59 (32%)
LRR_RI <76..230 CDD:238064 40/153 (26%)
leucine-rich repeat 76..99 CDD:275380 5/22 (23%)
leucine-rich repeat 100..123 CDD:275380 6/22 (27%)
LRR_8 122..182 CDD:290566 15/59 (25%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
leucine-rich repeat 148..171 CDD:275380 4/22 (18%)
LRR_8 170..230 CDD:290566 17/59 (29%)
leucine-rich repeat 172..195 CDD:275380 4/22 (18%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
LRRC55NP_001005210.2 PLN00113 <47..>201 CDD:331614 48/176 (27%)
leucine-rich repeat 47..66 CDD:275380 7/18 (39%)
LRR 1 66..87 5/20 (25%)
leucine-rich repeat 67..90 CDD:275380 5/22 (23%)
LRR_8 90..148 CDD:316378 18/70 (26%)
LRR 2 90..111 6/20 (30%)
leucine-rich repeat 91..114 CDD:275380 6/22 (27%)
LRR 3 114..135 8/20 (40%)
leucine-rich repeat 115..138 CDD:275380 7/22 (32%)
LRR 4 138..160 8/44 (18%)
leucine-rich repeat 139..163 CDD:275380 9/46 (20%)
LRR 5 163..186 9/22 (41%)
leucine-rich repeat 164..187 CDD:275380 8/22 (36%)
TPKR_C2 196..247 CDD:326558 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.