Sequence 1: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005210.2 | Gene: | LRRC55 / 219527 | HGNCID: | 32324 | Length: | 298 | Species: | Homo sapiens |
Alignment Length: | 224 | Identity: | 62/224 - (27%) |
---|---|---|---|
Similarity: | 96/224 - (42%) | Gaps: | 29/224 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 LLLCVLLQVCRSKTQSQMFCPTVCHCDLHAQRNRAV-CSAKRLISANIEIPTTVELLDLSYNDIT 87
Fly 88 TIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHILESNNQLIHLN 152
Fly 153 LEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLLTLSPGDFHAP 217
Fly 218 RNLASLNVEENPFNCDRALAKVATGLRQR 246 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 19/59 (32%) |
LRR_RI | <76..230 | CDD:238064 | 40/153 (26%) | ||
leucine-rich repeat | 76..99 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 100..123 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 122..182 | CDD:290566 | 15/59 (25%) | ||
leucine-rich repeat | 124..147 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 148..171 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 170..230 | CDD:290566 | 17/59 (29%) | ||
leucine-rich repeat | 172..195 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 196..219 | CDD:275380 | 8/22 (36%) | ||
LRRC55 | NP_001005210.2 | PLN00113 | <47..>201 | CDD:331614 | 48/176 (27%) |
leucine-rich repeat | 47..66 | CDD:275380 | 7/18 (39%) | ||
LRR 1 | 66..87 | 5/20 (25%) | |||
leucine-rich repeat | 67..90 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 90..148 | CDD:316378 | 18/70 (26%) | ||
LRR 2 | 90..111 | 6/20 (30%) | |||
leucine-rich repeat | 91..114 | CDD:275380 | 6/22 (27%) | ||
LRR 3 | 114..135 | 8/20 (40%) | |||
leucine-rich repeat | 115..138 | CDD:275380 | 7/22 (32%) | ||
LRR 4 | 138..160 | 8/44 (18%) | |||
leucine-rich repeat | 139..163 | CDD:275380 | 9/46 (20%) | ||
LRR 5 | 163..186 | 9/22 (41%) | |||
leucine-rich repeat | 164..187 | CDD:275380 | 8/22 (36%) | ||
TPKR_C2 | 196..247 | CDD:326558 | 6/19 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |