| Sequence 1: | NP_001285960.1 | Gene: | CG18480 / 34920 | FlyBaseID: | FBgn0028518 | Length: | 550 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001073982.3 | Gene: | CPN2 / 1370 | HGNCID: | 2313 | Length: | 545 | Species: | Homo sapiens |
| Alignment Length: | 235 | Identity: | 60/235 - (25%) |
|---|---|---|---|
| Similarity: | 99/235 - (42%) | Gaps: | 25/235 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 PKMWLGLKQILLYVGLLLCVLLQVCRSKTQSQMFCPTVCHCDLHAQRNRAVCSAKRLISANIEIP 73
Fly 74 TTVELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQID 138
Fly 139 EHILESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQ 203
Fly 204 NLLLTLSPGDFHAPRNLASLNVEENPFNCDRALAKVATGL 243 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18480 | NP_001285960.1 | LRR_8 | 74..134 | CDD:290566 | 11/59 (19%) |
| LRR_RI | <76..230 | CDD:238064 | 41/153 (27%) | ||
| leucine-rich repeat | 76..99 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 122..182 | CDD:290566 | 15/59 (25%) | ||
| leucine-rich repeat | 124..147 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 170..230 | CDD:290566 | 22/59 (37%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 11/22 (50%) | ||
| CPN2 | NP_001073982.3 | LRRNT | 21..53 | CDD:214470 | 9/35 (26%) |
| leucine-rich repeat | 30..53 | CDD:275380 | 5/26 (19%) | ||
| leucine-rich repeat | 75..98 | CDD:275380 | 5/22 (23%) | ||
| LRR 1 | 98..119 | 4/20 (20%) | |||
| leucine-rich repeat | 99..122 | CDD:275380 | 3/22 (14%) | ||
| LRR_8 | 121..181 | CDD:290566 | 21/59 (36%) | ||
| LRR 2 | 122..143 | 7/20 (35%) | |||
| leucine-rich repeat | 123..146 | CDD:275380 | 7/22 (32%) | ||
| LRR 3 | 146..167 | 7/20 (35%) | |||
| leucine-rich repeat | 147..170 | CDD:275380 | 8/22 (36%) | ||
| LRR_RI | 149..>356 | CDD:238064 | 24/70 (34%) | ||
| LRR_8 | 169..229 | CDD:290566 | 17/50 (34%) | ||
| LRR 4 | 170..191 | 10/20 (50%) | |||
| leucine-rich repeat | 171..194 | CDD:275380 | 11/22 (50%) | ||
| LRR 5 | 194..215 | 6/25 (24%) | |||
| leucine-rich repeat | 195..218 | CDD:275380 | 6/24 (25%) | ||
| LRR_8 | 218..277 | CDD:290566 | |||
| LRR 6 | 218..239 | ||||
| leucine-rich repeat | 219..242 | CDD:275380 | |||
| LRR 7 | 242..263 | ||||
| leucine-rich repeat | 243..266 | CDD:275380 | |||
| LRR 8 | 266..287 | ||||
| leucine-rich repeat | 267..290 | CDD:275380 | |||
| LRR 9 | 290..311 | ||||
| leucine-rich repeat | 291..314 | CDD:275380 | |||
| LRR_8 | 294..349 | CDD:290566 | |||
| LRR 10 | 314..335 | ||||
| leucine-rich repeat | 315..338 | CDD:275380 | |||
| LRR 11 | 338..359 | ||||
| leucine-rich repeat | 339..359 | CDD:275380 | |||
| LRR 12 | 362..383 | ||||
| leucine-rich repeat | 363..382 | CDD:275380 | |||
| leucine-rich repeat | 387..399 | CDD:275378 | |||
| LRRCT | 395..446 | CDD:214507 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||