DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18480 and LRRC38

DIOPT Version :9

Sequence 1:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001010847.1 Gene:LRRC38 / 126755 HGNCID:27005 Length:294 Species:Homo sapiens


Alignment Length:370 Identity:80/370 - (21%)
Similarity:125/370 - (33%) Gaps:111/370 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CPTVCHC-DLHAQRNRAVCSAKRLISANIEIPTTVELLDLSYNDITTIDDDSFKTTIHLLNLTLA 106
            ||..|.| |.|.    ..|..:.|.|.....|..|..|.::.|.|..|.:|.|.....|:.|...
Human    28 CPAGCACTDPHT----VDCRDRGLPSVPDPFPLDVRKLLVAGNRIQRIPEDFFIFYGDLVYLDFR 88

  Fly   107 HNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEHILESNNQLIHLNLEGNKLSTLGKGPILRSPS 171
            :|::.:|....|....:|.:||||||.|.|:......|..:|:.|:|..|.|..:.:.......|
Human    89 NNSLRSLEEGTFSGSAKLVFLDLSYNNLTQLGAGAFRSAGRLVKLSLANNNLVGVHEDAFETLES 153

  Fly   172 LRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLLTLSPGDFHAPRNLASLNVEENPFNCDRAL 236
            |:.|.|.::.:..|....|:|||.||                        ||.::.||:.||...
Human   154 LQVLELNDNNLRSLSVAALAALPALR------------------------SLRLDGNPWLCDCDF 194

  Fly   237 AKVATGLRQRGVAIFMSNCMEEEVQDHQDDAEAVNFPNKNEKFESMEYLEPSTRGPQSVLSVWRD 301
            |.:.:.:::                      .|...|                          :.
Human   195 AHLFSWIQE----------------------NASKLP--------------------------KG 211

  Fly   302 LDSSEEQNSSQDDEQMSSLSDVCEGSREKLCLRYRICLERVSHELLAGGNSQLEDEIIRTHTYDE 366
            ||  |.|.|...:.:..||.::.|.|..: | |:.:.|                           
Human   212 LD--EIQCSLPMESRRISLRELSEASFSE-C-RFSLSL--------------------------- 245

  Fly   367 DDLKLAFVVGGATGVCMVI---FIITFALCLKSCCEMRKKKSNPE 408
            .||.:....|.|..:..:|   |:.|...||:.|...:..:...|
Human   246 TDLCIIIFSGVAVSIAAIISSFFLATVVQCLQRCAPNKDAEDEDE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 19/59 (32%)
LRR_RI <76..230 CDD:238064 41/153 (27%)
leucine-rich repeat 76..99 CDD:275380 7/22 (32%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
LRR_8 122..182 CDD:290566 19/59 (32%)
leucine-rich repeat 124..147 CDD:275380 10/22 (45%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
LRR_8 170..230 CDD:290566 14/59 (24%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
leucine-rich repeat 196..219 CDD:275380 2/22 (9%)
LRRC38NP_001010847.1 LRRNT 27..58 CDD:214470 10/33 (30%)
leucine-rich repeat 38..56 CDD:275380 4/21 (19%)
LRR_RI <45..>165 CDD:238064 34/119 (29%)
LRR 1 57..78 7/20 (35%)
LRR_8 58..116 CDD:290566 19/57 (33%)
leucine-rich repeat 58..81 CDD:275378 7/22 (32%)
LRR 2 81..102 5/20 (25%)
leucine-rich repeat 82..105 CDD:275378 5/22 (23%)
LRR 3 105..126 9/20 (45%)
leucine-rich repeat 106..129 CDD:275378 10/22 (45%)
LRR_8 109..164 CDD:290566 18/54 (33%)
LRR 4 129..150 5/20 (25%)
leucine-rich repeat 130..153 CDD:275378 5/22 (23%)
LRR 5 153..174 6/20 (30%)
leucine-rich repeat 154..165 CDD:275378 3/10 (30%)
leucine-rich repeat 178..197 CDD:275380 9/42 (21%)
TPKR_C2 186..237 CDD:301599 16/100 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.