DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and Tnfaip6

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_445834.1 Gene:Tnfaip6 / 84397 RGDID:621359 Length:275 Species:Rattus norvegicus


Alignment Length:174 Identity:38/174 - (21%)
Similarity:62/174 - (35%) Gaps:57/174 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LCSGIFPAPFNTHYDETDPELTAGYFQGDMDVDYARNGQLSETRRW------PNA-------TVP 65
            :|:..:.|.....|....|....|:.:..: :||..  :|:.:.||      |||       |.|
  Rat    81 VCAAGWMAKGRVGYPIVKPGPNCGFGKTGI-IDYGI--RLNRSERWDAYCYNPNAKECGGVFTDP 142

  Fly    66 YRI------SEEFDAPHVEY----IKLG----MQFIEYS-----SCIRFVPADEDEENYLFVLPS 111
            .||      ..|:|...|.|    :|.|    :.|:::.     .|:    ||     |:.:..|
  Rat   143 KRIFKSPGFPNEYDDNQVCYWHIRLKYGQRIHLSFLDFDLEHDPGCL----AD-----YVEIYDS 198

  Fly   112 TSGCSSKVGYQPGER------------TVK-LKPGSLDTGCFKL 142
            .......||...|:.            |:| |...|:..|.|::
  Rat   199 YDDVHGFVGRYCGDELPEDIISTGNVMTLKFLSDASVTAGGFQI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 30/131 (23%)
ZnMc_astacin_like 61..248 CDD:239807 27/121 (22%)
Tnfaip6NP_445834.1 Link_domain_TSG_6_like 36..128 CDD:239592 10/49 (20%)
CUB 135..244 CDD:395345 25/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.