DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and Bmp1

DIOPT Version :10

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_112613.1 Gene:Bmp1 / 83470 RGDID:620739 Length:990 Species:Rattus norvegicus


Alignment Length:210 Identity:68/210 - (32%)
Similarity:98/210 - (46%) Gaps:32/210 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RRWPNATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGY 121
            |.||:..:|:.|...|........:..|:..|..:|:.|:.. .||::|:.......||.|.||.
  Rat   132 RVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLER-TDEDSYIVFTYRPCGCCSYVGR 195

  Fly   122 QPGERTVKLKPGSLDTG--CFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFV 184
            :.|      .|.::..|  |.|.|.:.|||.|.:||.|:...|:||..|.||.|||..|.|.||:
  Rat   196 RGG------GPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDRHVSIVRENIQPGQEYNFL 254

  Fly   185 KYEEDEVGDFDQPYDYGSILHYSSLAFS-------------INGEATIVALNPEGQEQMGQRLMM 236
            |.|..||....:.||:.||:||:...||             :||      :.|    .:|||..:
  Rat   255 KMEVQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNG------VKP----SIGQRTRL 309

  Fly   237 SDTDVKRLNTMYKCP 251
            |..|:.:...:||||
  Rat   310 SKGDIAQARKLYKCP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 ZnMc_astacin_like 61..248 CDD:239807 61/201 (30%)
Bmp1NP_112613.1 ZnMc_BMP1_TLD 125..324 CDD:239808 66/208 (32%)
CUB 326..435 CDD:395345
CUB 439..548 CDD:395345
FXa_inhibition 559..591 CDD:464251
CUB 595..704 CDD:395345
FXa_inhibition 711..746 CDD:464251
CUB 751..860 CDD:395345
CUB 864..977 CDD:395345
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.