Sequence 1: | NP_609760.1 | Gene: | CG7631 / 34919 | FlyBaseID: | FBgn0028945 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001099551.1 | Gene: | Tll1 / 678743 | RGDID: | 1306120 | Length: | 1013 | Species: | Rattus norvegicus |
Alignment Length: | 204 | Identity: | 69/204 - (33%) |
---|---|---|---|
Similarity: | 100/204 - (49%) | Gaps: | 13/204 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 54 SETRR-WPNATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSS 117
Fly 118 KVGYQ-PGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEK 181
Fly 182 NFVKYEEDEVGDFDQPYDYGSILHYSSLAFSING---EATIVALNPEG-QEQMGQRLMMSDTDVK 242
Fly 243 RLNTMYKCP 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7631 | NP_609760.1 | Astacin | 57..251 | CDD:279708 | 65/199 (33%) |
ZnMc_astacin_like | 61..248 | CDD:239807 | 61/191 (32%) | ||
Tll1 | NP_001099551.1 | ZnMc_BMP1_TLD | 148..347 | CDD:239808 | 67/202 (33%) |
Astacin | 155..348 | CDD:279708 | 67/200 (34%) | ||
CUB | 349..458 | CDD:278839 | |||
CUB | 462..571 | CDD:278839 | |||
FXa_inhibition | 582..614 | CDD:291342 | |||
CUB | 618..727 | CDD:278839 | |||
FXa_inhibition | 734..769 | CDD:291342 | |||
CUB | 774..883 | CDD:278839 | |||
CUB | 887..1000 | CDD:278839 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |