DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and astl2c

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001037864.1 Gene:astl2c / 594901 XenbaseID:XB-GENE-6449741 Length:496 Species:Xenopus tropicalis


Alignment Length:272 Identity:82/272 - (30%)
Similarity:125/272 - (45%) Gaps:39/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FQLFLLGTLCSGIFPAPF-NTHYDETDPELTAG------------------YFQGDMDVDYARNG 51
            |.||    :|:..||... ..|.::.|.|:...                  :.|||:...::|:.
 Frog    11 FGLF----VCATSFPIQIVFPHVEQNDTEVPDNDDDVFGRILRANKGKRNFHVQGDIAHKFSRSA 71

  Fly    52 QLSETRRWPN-----ATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPS 111
            ...:...||.     ..|||.||.::.......|...||.....:|::|:| ..||::|:.:.| 
 Frog    72 INCKECLWPKDSNGIVNVPYTISSDYSQNEASLIMAAMQEFATLTCVQFIP-QTDEDDYIAIQP- 134

  Fly   112 TSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENIS 176
            ..||.|.:|...|.:.|.|..|    ||...|.|||||.|.|||.|:....:||.:|.|..:.||
 Frog   135 LDGCWSYIGVNGGAQQVSLGKG----GCIYYGVIQHELNHVLGFVHEHSRSDRDNYVHINYQYIS 195

  Fly   177 EGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFS-INGEATIVALNPEGQEQMGQRLMMSDTD 240
            ..:...|.|.:.|.:|   ..|||.|::||...::| ..|:.|||.: |.....:|||..:|..|
 Frog   196 PDNIAFFDKKDTDNLG---LEYDYSSVMHYPGYSYSNTTGKNTIVPI-PNANVPIGQRYGLSTLD 256

  Fly   241 VKRLNTMYKCPI 252
            |.::|.:|:|.:
 Frog   257 VSKINRLYQCDV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 68/199 (34%)
ZnMc_astacin_like 61..248 CDD:239807 65/192 (34%)
astl2cNP_001037864.1 ZnMc_hatching_enzyme 84..266 CDD:239810 66/191 (35%)
Astacin 89..266 CDD:279708 66/186 (35%)
CUB 270..380 CDD:238001
CUB 383..495 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.