DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and he1.1

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001038639.1 Gene:he1.1 / 569018 ZFINID:ZDB-GENE-021211-3 Length:263 Species:Danio rerio


Alignment Length:230 Identity:82/230 - (35%)
Similarity:119/230 - (51%) Gaps:18/230 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ETDPELTAGYFQGDMDVDYARNGQLSETRR--W-PNAT----VPYRISEEFDAPHVEYIKLGMQF 86
            ||:...:...|:||:.:...||..:.|.:.  | .||.    |||.:|.||.......|...:..
Zfish    44 ETNKGSSEVLFEGDVVLPKNRNAFICEDKSCFWKKNANNIVEVPYVVSGEFSINDKSVIANAISI 108

  Fly    87 IEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLH 151
            ....:||||||. ..:.:||.: .:..||.|.:|...|::.|.|.    ..||...|..||||.|
Zfish   109 FHAQTCIRFVPR-SIQADYLSI-ENKDGCYSAIGRTGGKQVVSLN----RKGCVYSGIAQHELNH 167

  Fly   152 TLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSIN-G 215
            .|||:|:|...:||::|:|...|||.|...||:|   .:..:.:.||||||::||...||:|. |
Zfish   168 ALGFYHEQSRSDRDQYVRINWNNISPGMAYNFLK---QKTNNQNTPYDYGSLMHYGKTAFAIQPG 229

  Fly   216 EATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKC 250
            ..||..: |:...|:|||..:|..|:.|:|.:|.|
Zfish   230 LETITPI-PDENVQIGQRQGLSKIDILRINKLYGC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 74/202 (37%)
ZnMc_astacin_like 61..248 CDD:239807 71/191 (37%)
he1.1NP_001038639.1 ZnMc_hatching_enzyme 81..263 CDD:239810 70/191 (37%)
Astacin 86..263 CDD:279708 70/186 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.