DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and mep1a.2

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001122199.1 Gene:mep1a.2 / 565535 ZFINID:ZDB-GENE-041001-208 Length:689 Species:Danio rerio


Alignment Length:255 Identity:88/255 - (34%)
Similarity:125/255 - (49%) Gaps:24/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FLLGTLCSGIFPAPFNTHYD---------ETDPELTAGYFQGDMDVDYARNGQLSETRRWPNATV 64
            |:|..|.:...||.:....|         |.:.:.....|:||:..|..||..:.|..|| ...:
Zfish    11 FVLLALKACALPAQYGEDADAGELREDILEINLDSQRELFEGDIAGDPRRNAIIDEKARW-QFPI 74

  Fly    65 PYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGERTVK 129
            ||.:::..|......|...::.....||:.|.|. |.|..|: ......||.|.||        .
Zfish    75 PYILTDTLDLNAKGVILQALEMYRLKSCVDFKPY-EGESTYI-SFTKLDGCWSFVG--------D 129

  Fly   130 LKPG---SLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEV 191
            ||.|   |:...|.....::|||||.|||:|:|...:||::|||..:.|.||.|.||.|||:|.:
Zfish   130 LKTGQNVSIGERCDTKAIVEHELLHALGFYHEQSRSDRDDYVKIWWDQIIEGKEHNFNKYEDDFI 194

  Fly   192 GDFDQPYDYGSILHYSSLAFSINGE-ATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKC 250
            .|.:.||||.||:||..|:|:.:.: .||....|.....:||||..|..|::|||.||:|
Zfish   195 TDLNTPYDYESIMHYRPLSFNKDPDIPTITTTIPAFNNIIGQRLDFSALDLERLNRMYEC 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 74/198 (37%)
ZnMc_astacin_like 61..248 CDD:239807 69/190 (36%)
mep1a.2NP_001122199.1 ZnMc 26..254 CDD:294052 82/238 (34%)
Astacin 68..256 CDD:279708 74/198 (37%)
MAM 259..423 CDD:214533
MAM 264..423 CDD:99706
MATH 423..579 CDD:295307
EGF 619..653 CDD:278437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.