DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and hce2l1

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_009302797.1 Gene:hce2l1 / 564183 ZFINID:ZDB-GENE-070912-147 Length:232 Species:Danio rerio


Alignment Length:203 Identity:76/203 - (37%)
Similarity:107/203 - (52%) Gaps:15/203 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LSETRRWPNAT-----VPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPST 112
            |.::.|||.|.     |||.:|..:|......|:.||..|..|:|::|||... :.|:|.:.| .
Zfish    36 LGDSCRWPKAVDGFVYVPYIMSTLYDDMDRITIETGMLDISSSTCVKFVPRTH-QANFLNIQP-R 98

  Fly   113 SGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISE 177
            .||.|.:|...|.:||.|:    ..||...|...|||:|.|||.|:|...:||.:|.|:.|||.|
Zfish    99 YGCWSYLGMTGGSQTVSLQ----SPGCMWSGVASHELMHALGFVHEQSRSDRDRYVSILWENIIE 159

  Fly   178 GHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTDVK 242
            ....||.||   |..:.:..|||.|::||...|||.:|..||:. .|:....:|||...|..|:.
Zfish   160 NQRHNFRKY---ETNNLNTAYDYSSVMHYGRYAFSEDGGPTIIP-KPDPYIPIGQRDGPSILDIH 220

  Fly   243 RLNTMYKC 250
            ::|.:|.|
Zfish   221 KINILYNC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 75/199 (38%)
ZnMc_astacin_like 61..248 CDD:239807 70/191 (37%)
hce2l1XP_009302797.1 Astacin 41..229 CDD:279708 75/198 (38%)
ZnMc_hatching_enzyme 47..228 CDD:239810 70/190 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.