DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and c6ast3

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001013544.1 Gene:c6ast3 / 541399 ZFINID:ZDB-GENE-050320-99 Length:255 Species:Danio rerio


Alignment Length:199 Identity:73/199 - (36%)
Similarity:110/199 - (55%) Gaps:19/199 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WPNAT-----VPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSK 118
            ||..:     |||.|:..:.:..:|.|:.|:....||:||||.|.. :|.:|:.: .|.|||.|.
Zfish    69 WPKYSDGKIYVPYVIANHYSSRELEIIQRGLDSFSYSTCIRFFPRG-NERDYISI-ESRSGCYSY 131

  Fly   119 VGYQPGERTVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNF 183
            ||.|...:||.|    ..:||....|:||||||.|||:|:|...:||..::::.|||.:.     
Zfish   132 VGRQGYAQTVSL----ARSGCLYHSTVQHELLHALGFNHEQTRNDRDNHIQVIWENILDD----- 187

  Fly   184 VKYEEDEVGDFDQ--PYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLNT 246
            :||..::|...:|  ||||.|::.|...|||.||..|::.: |.....:|....||..|:.|:|.
Zfish   188 MKYNFNKVNTLNQGTPYDYSSVMQYERYAFSKNGLPTMIPI-PNNNAALGTSTEMSQNDIIRINR 251

  Fly   247 MYKC 250
            :|:|
Zfish   252 LYQC 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 73/199 (37%)
ZnMc_astacin_like 61..248 CDD:239807 69/193 (36%)
c6ast3NP_001013544.1 Astacin 68..255 CDD:279708 72/197 (37%)
ZnMc 74..255 CDD:294052 70/192 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.