DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and tll1

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001008039.1 Gene:tll1 / 493401 XenbaseID:XB-GENE-479941 Length:495 Species:Xenopus tropicalis


Alignment Length:255 Identity:83/255 - (32%)
Similarity:120/255 - (47%) Gaps:32/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SGIFPAPFNTHYDETDPELTAGY--------------FQGDMDVDYARNGQLSETRRWPNAT--- 63
            ||..|.|  ...|..||.....|              ..||:.:...||........||.::   
 Frog    23 SGTLPTP--KSQDGKDPADNNLYTDIMKANQKSKKLRIHGDIALKTDRNAINCTECLWPKSSDGF 85

  Fly    64 --VPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGER 126
              |||.:|.::....|..|...|:..|..:|::|.|. ..|::|| .:.|..||.|.:||..|.:
 Frog    86 VYVPYTVSSDYSQDEVNAITTAMKEYEGLTCVQFTPW-TGEDDYL-AIQSLDGCWSYIGYYGGSQ 148

  Fly   127 TVKLKPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEV 191
            .|.|..|.    |...|.:||||.|.|||:|:....:||::|.|:.:.||..:..||.|...:.:
 Frog   149 AVSLLKGF----CAYNGGVQHELNHALGFYHEHNRSDRDDYVTIMYQYISPENIGNFDKISTNNL 209

  Fly   192 GDFDQPYDYGSILHYSSLAFS-INGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKC 250
            |   ..|||.|||||:..||| .:|:.|||. :|.....:||...:|:.||.::|.:|.|
 Frog   210 G---VDYDYSSILHYAGNAFSNTSGQNTIVP-HPNPNVPIGQSYGLSNLDVLKINRLYGC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 71/200 (36%)
ZnMc_astacin_like 61..248 CDD:239807 67/192 (35%)
tll1NP_001008039.1 ZnMc_hatching_enzyme 83..265 CDD:239810 68/191 (36%)
CUB 269..379 CDD:238001
CUB 382..494 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.