DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and CG6763

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster


Alignment Length:256 Identity:99/256 - (38%)
Similarity:133/256 - (51%) Gaps:26/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LGTLCSGIFPAP-----------FNTHYDETDPELTAGYFQGDMDVDYA----RNGQLSETRRWP 60
            |||   .:|..|           |:...||.:||....|.:|||.|...    :||..:::.|||
  Fly    57 LGT---ALFGKPDEELTANRVGNFSADADEMNPEELGSYLEGDMLVPQTDLIMKNGLPTQSSRWP 118

  Fly    61 NATVPYRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGE 125
            |..|||.|...|:|..:..|:..:......:|||||.. ..|.:|:.:....|||.|.||...|:
  Fly   119 NGVVPYEIRGNFNARDMATIENAIGEYHRRTCIRFVKR-SSERDYISIRGDNSGCWSSVGRVGGK 182

  Fly   126 RTVKLK-PGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEED 189
            :.|.|: ||.|.    :.||..|||:|.|||.|:|....||.:|.|...|:......||.|....
  Fly   183 QEVNLQSPGCLS----RPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAART 243

  Fly   190 EVGDFDQPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKC 250
            |.  |..||||||::|||..||||||:.||:|:...|.::||||...||.|:::||.||.|
  Fly   244 EA--FGVPYDYGSVMHYSKNAFSINGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 82/195 (42%)
ZnMc_astacin_like 61..248 CDD:239807 76/187 (41%)
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 82/194 (42%)
ZnMc_astacin_like 119..300 CDD:239807 76/187 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444909
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.