DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7631 and npsn

DIOPT Version :9

Sequence 1:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_991319.2 Gene:npsn / 404039 ZFINID:ZDB-GENE-040420-2 Length:280 Species:Danio rerio


Alignment Length:232 Identity:84/232 - (36%)
Similarity:120/232 - (51%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DETD-PELTAGYFQGDMDVDYARNGQLSE--TRR---WPNAT-----VPYRISEEFDAPHVEYIK 81
            :.|| |.:..|      |:.:.|..|.::  |.|   |..:.     |||:||..:....|..|:
Zfish    57 ENTDGPVILFG------DIAFPRGLQNADQCTARGCKWDRSRDGLVYVPYQISRAYSPREVAVIE 115

  Fly    82 LGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGTIQ 146
            .|:|.....||||||| ...|.|||.: .|.|||.|.:|...|.:.|.|:    ..||....|:|
Zfish   116 QGLQSFSAVSCIRFVP-HTGERNYLNI-KSESGCYSYLGRIGGGQVVSLQ----RQGCVYFSTVQ 174

  Fly   147 HELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSLAF 211
            |||||.|||||:|...:||..::|:.:||....:.||.|...:.:|   .||||.|::.||..||
Zfish   175 HELLHALGFHHEQNRSDRDNHIRILYQNIIPAQQYNFNKQNTNNLG---TPYDYNSVMQYSRYAF 236

  Fly   212 SINGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMY 248
            |:|.:.|:|.: |.....:|:...||..|:.|:|.:|
Zfish   237 SMNNQPTMVPV-PNANVVLGEAQSMSPNDILRINRLY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7631NP_609760.1 Astacin 57..251 CDD:279708 76/200 (38%)
ZnMc_astacin_like 61..248 CDD:239807 73/191 (38%)
npsnNP_991319.2 Astacin 87..275 CDD:279708 75/196 (38%)
ZnMc_hatching_enzyme 93..273 CDD:239810 74/190 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.